StarFunc result for job id Q02641

User Input

>input (598 residues)
MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR
LGSSKSGDNSSSSLGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLK
GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA
EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRG
KSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP
NPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYP
SSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGT
PPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02641	1.000	1.000	1.049E-100	598	1.000	1.000	Q02641.pdb.gz	CACB1_HUMAN Voltage-dependent L-type calcium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=CACNB1 PE=1 SV=3
2	AFDB:Q2Q551	0.607	0.603	1.502E-78	603	0.759	0.753	Q2Q551.pdb.gz	Q2Q551_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
3	AFDB:P19517	0.580	0.661	3.729E-75	524	0.736	0.840	P19517.pdb.gz	CACB1_RABIT Voltage-dependent L-type calcium channel subunit beta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNB1 PE=1 SV=1
4	AFDB:F1R605	0.551	0.631	2.387E-66	520	0.651	0.748	F1R605.pdb.gz
5	AFDB:B2XY76	0.548	0.515	3.491E-63	637	0.548	0.515	B2XY76.pdb.gz
6	AFDB:P54284	0.549	0.676	4.401E-57	484	0.483	0.597	P54284.pdb.gz	CACB3_HUMAN Voltage-dependent L-type calcium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=CACNB3 PE=1 SV=1
7	AFDB:M9PD84	0.521	0.374	1.009E-51	844	0.502	0.355	M9PD84.pdb.gz	M9PD84_DROME Ca2+-channel-protein-beta-subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Ca-beta PE=3 SV=1
8	PDB:7mixC	0.471	0.852	1.119E-40	324	0.413	0.762	7mixC.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
9	PDB:6jpaC	0.294	0.978	1.415E-23	178	0.294	0.989	6jpaC.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
10	AFDB:B2XY79	0.214	0.578	2.344E-19	214	0.197	0.551	B2XY79.pdb.gz
11	AFDB:A0A0R4IM34	0.215	0.533	4.429E-18	231	0.192	0.498	A0A0R4IM34.pdb.gz
12	AFDB:B0F0C8	0.176	0.674	3.738E-13	150	0.140	0.560	B0F0C8.pdb.gz
13	PDB:2xkxA	0.194	0.165	1.641E-9	721	0.100	0.083	2xkxA.pdb.gz
14	PDB:4f4jA	0.207	0.577	1.245E-5	189	0.057	0.180	4f4jA.pdb.gz
15	PDB:1lvgA	0.209	0.576	4.276E-5	190	0.059	0.184	1lvgA.pdb.gz	Structural characterization of the closed conformation of mouse guanylate kinase.
16	PDB:6nuiA	0.220	0.590	7.257E-5	198	0.050	0.152	6nuiA.pdb.gz
17	PDB:1z8fA	0.197	0.546	9.736E-5	184	0.048	0.158	1z8fA.pdb.gz
18	PDB:1griA	0.071	0.191	2.944E-3	211	0.022	0.062	1griA.pdb.gz
19	PDB:3qwyA	0.085	0.289	2.944E-3	170	0.023	0.082	3qwyA.pdb.gz
20	PDB:2anbA	0.203	0.497	3.511E-3	206	0.047	0.136	2anbA.pdb.gz	Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A2SZ54	637	598	0.527	0.527	A2SZ54_DANRE Voltage-dependent L-type calcium channel subunit beta-2 OS=Danio rerio OX=7955 GN=cacnb2b PE=2 SV=1
2	A8WHZ5	571	485	0.488	0.602	A8WHZ5_DANRE Voltage-dependent L-type calcium channel subunit beta-3 OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
3	B0F0C6	555	489	0.500	0.611	B0F0C6_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
4	B0F0D0	595	519	0.518	0.597	B0F0D0_DANRE Calcium channel, voltage-dependent, beta 4a subunit OS=Danio rerio OX=7955 GN=cacnb4.2 PE=2 SV=1
5	B0F0D1	580	523	0.530	0.606	B0F0D1_DANRE Calcium channel, voltage-dependent, beta 4b subunit OS=Danio rerio OX=7955 GN=cacnb4.1 PE=2 SV=1
6	D4A055	633	519	0.540	0.622	CACB4_RAT Voltage-dependent L-type calcium channel subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Cacnb4 PE=1 SV=2
7	O00305	633	520	0.538	0.619	CACB4_HUMAN Voltage-dependent L-type calcium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=CACNB4 PE=1 SV=2
8	P19517	794	524	0.729	0.832	CACB1_RABIT Voltage-dependent L-type calcium channel subunit beta-1 OS=Oryctolagus cuniculus OX=9986 GN=CACNB1 PE=1 SV=1
9	P54283	1192	597	0.972	0.973	CACB1_RAT Voltage-dependent L-type calcium channel subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Cacnb1 PE=1 SV=1
10	P54284	547	484	0.455	0.562	CACB3_HUMAN Voltage-dependent L-type calcium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=CACNB3 PE=1 SV=1
11	P54285	550	484	0.457	0.564	CACB3_MOUSE Voltage-dependent L-type calcium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Cacnb3 PE=1 SV=2
12	P54287	546	484	0.453	0.560	CACB3_RAT Voltage-dependent L-type calcium channel subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Cacnb3 PE=1 SV=1
13	P54288	706	632	0.661	0.625	CACB2_RABIT Voltage-dependent L-type calcium channel subunit beta-2 OS=Oryctolagus cuniculus OX=9986 GN=CACNB2 PE=1 SV=1
14	Q02641	1231	598	1.000	1.000	CACB1_HUMAN Voltage-dependent L-type calcium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=CACNB1 PE=1 SV=3
15	Q08289	705	660	0.676	0.612	CACB2_HUMAN Voltage-dependent L-type calcium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=CACNB2 PE=1 SV=3
16	Q2Q551	798	603	0.766	0.760	Q2Q551_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
17	Q6DG31	718	478	0.656	0.820	Q6DG31_DANRE Voltage-dependent L-type calcium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:91982 PE=2 SV=1
18	Q8CC27	687	655	0.657	0.600	CACB2_MOUSE Voltage-dependent L-type calcium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Cacnb2 PE=1 SV=1
19	Q8R0S4	633	519	0.540	0.622	CACB4_MOUSE Voltage-dependent L-type calcium channel subunit beta-4 OS=Mus musculus OX=10090 GN=Cacnb4 PE=1 SV=2
20	Q8R3Z5	1198	597	0.977	0.978	CACB1_MOUSE Voltage-dependent L-type calcium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Cacnb1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00625 Guanylate_kin	3e-46	168.9	Guanylate kinase
2	PF00018 SH3_1	2.5	19.1	SH3 domain
3	PF07653 SH3_2	2.7e+02	12.8	Variant SH3 domain
4	PF12052 VGCC_beta4Aa_N	1.7e-19	80.9	Voltage gated calcium channel subunit beta domain 4Aa N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377840

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349320	0.998	Voltage-dependent calcium channel subunit alpha-2/delta-1
2	9606.ENSP00000226021	0.989	Voltage-dependent calcium channel gamma-1 subunit
3	9606.ENSP00000288139	0.973	Voltage-dependent L-type calcium channel subunit alpha-1D
4	9606.ENSP00000418081	0.968	Voltage-dependent calcium channel subunit alpha-2/delta-2
5	9606.ENSP00000266376	0.962	Voltage-dependent L-type calcium channel subunit alpha-1C
6	9606.ENSP00000355192	0.946	Voltage-dependent L-type calcium channel subunit alpha-1S
7	9606.ENSP00000419101	0.937	Voltage-dependent calcium channel subunit alpha-2/delta-3
8	9606.ENSP00000365441	0.933	Voltage-dependent L-type calcium channel subunit alpha-1F
9	9606.ENSP00000372169	0.932	Voltage-dependent calcium channel subunit alpha-2/delta-4
10	9606.ENSP00000353362	0.909	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
11	9606.ENSP00000352011	0.905	Voltage-dependent T-type calcium channel subunit alpha-1G
12	9606.ENSP00000320025	0.882	Voltage-dependent L-type calcium channel subunit beta-2
13	9606.ENSP00000360423	0.878	Voltage-dependent N-type calcium channel subunit alpha-1B
14	9606.ENSP00000005284	0.876	Voltage-dependent calcium channel gamma-3 subunit
15	9606.ENSP00000356545	0.876	Voltage-dependent R-type calcium channel subunit alpha-1E
16	9606.ENSP00000301050	0.863	Voltage-dependent L-type calcium channel subunit beta-3
17	9606.ENSP00000375647	0.859	Voltage-dependent calcium channel gamma-7 subunit
18	9606.ENSP00000270458	0.853	Voltage-dependent calcium channel gamma-8 subunit
19	9606.ENSP00000262138	0.848	Voltage-dependent calcium channel gamma-4 subunit
20	9606.ENSP00000334198	0.842	Voltage-dependent T-type calcium channel subunit alpha-1H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005245	1.000	voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.963	regulation of cellular process
GO:0051179	0.905	localization
GO:0006816	0.890	calcium ion transport
GO:0050896	0.860	response to stimulus
GO:0051716	0.785	cellular response to stimulus
GO:0032501	0.735	multicellular organismal process
GO:0032879	0.677	regulation of localization
GO:0051641	0.668	cellular localization
GO:0033036	0.637	macromolecule localization
GO:0072657	0.544	protein localization to membrane
GO:0051049	0.497	regulation of transport
GO:0007154	0.465	cell communication
GO:0023052	0.464	signaling
GO:0042221	0.403	response to chemical
GO:0043269	0.315	regulation of monoatomic ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005891	1.000	voltage-gated calcium channel complex
GO:0005622	0.747	intracellular anatomical structure
GO:0005737	0.741	cytoplasm
GO:0043226	0.706	organelle
GO:0030054	0.353	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]