StarFunc result for job id Q02742

User Input

>input (428 residues)
MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAGENPSSDINCT
KVLQGDVNEIQKVKLEILTVKFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAE
FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASCFSNVFVAS
RLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGEN
NLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVL
QNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFE
GDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRH
KALETLKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02742	1.000	1.000	3.338E-85	428	1.000	1.000	Q02742.pdb.gz	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
2	AFDB:Q09324	0.965	0.965	2.998E-74	428	0.836	0.836	Q09324.pdb.gz	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
3	PDB:2gamC	0.866	0.990	4.080E-64	374	0.745	0.853	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
4	AFDB:O95395	0.865	0.846	1.281E-53	438	0.514	0.502	O95395.pdb.gz	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
5	AFDB:Q5JCT0	0.874	0.857	1.888E-53	437	0.512	0.501	Q5JCT0.pdb.gz	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
6	AFDB:E9Q649	0.807	0.760	3.134E-44	455	0.425	0.400	E9Q649.pdb.gz	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
7	AFDB:Q9P109	0.797	0.754	1.004E-43	453	0.409	0.386	Q9P109.pdb.gz	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
8	AFDB:Q6T5D9	0.739	0.788	1.985E-38	400	0.367	0.393	Q6T5D9.pdb.gz	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
9	AFDB:Q6T5E1	0.730	0.780	8.388E-38	400	0.355	0.380	Q6T5E1.pdb.gz	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
10	AFDB:Q8N0V5	0.714	0.758	1.543E-37	402	0.336	0.358	Q8N0V5.pdb.gz	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
11	AFDB:P97402	0.713	0.759	2.840E-37	401	0.346	0.369	P97402.pdb.gz	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
12	PDB:6fxrA	0.255	0.167	3.197E-4	700	0.061	0.037	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
13	PDB:7jhiC	0.373	0.459	3.572E-4	331	0.070	0.091	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
14	PDB:3r2wC	0.243	0.233	5.882E-4	450	0.065	0.062	3r2wC.pdb.gz
15	PDB:4y63A	0.271	0.374	9.165E-4	282	0.077	0.117	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
16	PDB:1i52A	0.233	0.403	1.351E-3	225	0.049	0.093	1i52A.pdb.gz	Structure of 4-diphosphocytidyl-2-C- methylerythritol synthetase involved in mevalonate- independent isoprenoid biosynthesis.
17	PDB:6r8uA	0.206	0.207	1.991E-3	425	0.089	0.089	6r8uA.pdb.gz	The allosteric control mechanism of bacterial glycogen biosynthesis disclosed by cryoEM
18	PDB:5l6vI	0.227	0.240	2.105E-3	400	0.068	0.072	5l6vI.pdb.gz	Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
19	PDB:7x8kB	0.231	0.262	2.225E-3	367	0.054	0.063	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
20	PDB:6h0bB	0.252	0.212	2.486E-3	521	0.056	0.046	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02742	0.0	895	428	1.000	1.000	GCNT1_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2
2	Q09324	0.0	774	428	0.850	0.850	GCNT1_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2
3	Q64165	0.0	773	428	0.843	0.843	Q64165_RAT Glucosaminyl (N-acetyl) transferase 1 OS=Rattus norvegicus OX=10116 GN=Gcnt1 PE=4 SV=1
4	O95395	4.90e-155	447	438	0.491	0.479	GCNT3_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=GCNT3 PE=2 SV=1
5	Q8CH87	1.01e-150	436	437	0.472	0.462	GCNT3_RAT Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Gcnt3 PE=1 SV=1
6	Q5JCT0	1.61e-150	436	437	0.477	0.467	GCNT3_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 OS=Mus musculus OX=10090 GN=Gcnt3 PE=2 SV=2
7	E9Q649	1.24e-110	335	455	0.409	0.385	GCNT4_MOUSE Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
8	Q9P109	8.69e-109	330	453	0.393	0.371	GCNT4_HUMAN Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
9	Q6T5D9	2.62e-95	293	400	0.341	0.365	Q6T5D9_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
10	Q6T5E1	1.54e-93	289	400	0.332	0.355	Q6T5E1_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=2 SV=1
11	P97402	1.99e-93	289	401	0.362	0.387	GCNT2_MOUSE N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Mus musculus OX=10090 GN=Gcnt2 PE=2 SV=2
12	Q6T5E0	4.50e-91	283	400	0.367	0.393	Q6T5E0_RAT Glucosaminyl (N-acetyl) transferase 2 (I blood group) OS=Rattus norvegicus OX=10116 GN=Gcnt2 PE=4 SV=1
13	Q8N0V5	8.99e-86	269	402	0.332	0.353	GNT2A_HUMAN N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
14	Q7KVA1	7.10e-16	82.4	876	0.143	0.070	XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster OX=7227 GN=oxt PE=2 SV=1
15	Q9EPL0	6.74e-14	76.3	865	0.143	0.071	XYLT2_MOUSE Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3
16	Q9H1B5	1.49e-13	75.1	865	0.140	0.069	XYLT2_HUMAN Xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=XYLT2 PE=1 SV=2
17	D3J0E7	5.31e-13	73.6	919	0.143	0.066	D3J0E7_DANRE protein xylosyltransferase OS=Danio rerio OX=7955 GN=xylt1 PE=2 SV=1
18	Q9LE60	4.30e-12	69.7	424	0.143	0.144	Q9LE60_ARATH AT3g15350/K7L4_15 OS=Arabidopsis thaliana OX=3702 GN=At3g15350 PE=1 SV=1
19	Q86Y38	4.77e-12	70.5	959	0.133	0.059	XYLT1_HUMAN Xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=XYLT1 PE=1 SV=1
20	Q9EPI1	9.42e-12	69.3	821	0.133	0.069	XYLT1_RAT Xylosyltransferase 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Xylt1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02485 Branch	1.7e-58	209.6	Core-2/I-Branching enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428540	0.973	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
2	9606.ENSP00000389176	0.969	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
3	9606.ENSP00000484640	0.968	Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase
4	9606.ENSP00000156626	0.965	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
5	9606.ENSP00000304364	0.959	C1GALT1-specific chaperone 1
6	9606.ENSP00000321874	0.959	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
7	9606.ENSP00000377257	0.946	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
8	9606.ENSP00000360776	0.945	Beta-1,4-galactosyltransferase 5
9	9606.ENSP00000484824	0.943	Mucin-1
10	9606.ENSP00000414350	0.933	Mucin-20
11	9606.ENSP00000406861	0.929	Mucin-6
12	9606.ENSP00000441929	0.929	Mucin-12
13	9606.ENSP00000485659	0.928	Mucin-5AC
14	9606.ENSP00000485028	0.924	Mucin-13
15	9606.ENSP00000417498	0.922	Mucin-4
16	9606.ENSP00000381008	0.920	Mucin-16
17	9606.ENSP00000407422	0.917	Mucin-7
18	9606.ENSP00000416753	0.917	Mucin-15
19	9606.ENSP00000436812	0.917	Mucin-5B
20	9606.ENSP00000368771	0.914	Mucin-3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140103	1.000	catalytic activity, acting on a glycoprotein
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0003829	0.982	beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity
GO:0005488	0.975	binding
GO:0005515	0.971	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0070085	0.990	glycosylation
GO:1901135	0.988	carbohydrate derivative metabolic process
GO:0043412	0.987	macromolecule modification
GO:1901566	0.987	organonitrogen compound biosynthetic process
GO:0034645	0.987	cellular macromolecule biosynthetic process
GO:0019538	0.985	protein metabolic process
GO:0006486	0.976	protein glycosylation
GO:0006493	0.947	protein O-linked glycosylation
GO:0050900	0.444	leukocyte migration
GO:0045123	0.428	cellular extravasation
GO:0016266	0.375	O-glycan processing
GO:0065007	0.321	biological regulation
GO:0050789	0.309	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005794	0.998	Golgi apparatus
GO:0005576	0.991	extracellular region
GO:0031090	0.978	organelle membrane
GO:0005615	0.943	extracellular space
GO:0098588	0.940	bounding membrane of organelle
GO:0000139	0.905	Golgi membrane
GO:0031984	0.836	organelle subcompartment
GO:0098791	0.724	Golgi apparatus subcompartment
GO:0005795	0.477	Golgi stack
GO:0031985	0.455	Golgi cisterna
GO:0005802	0.411	trans-Golgi network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:18705	0.982	a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + UDP-N-acetyl-alpha-D-glucosamine = a beta-D-galactosyl-(1->3)-[N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl derivative + H(+) + UDP
EC:2.4.1.102	0.982	acetylglucosaminyltransferase.

[back to server]