StarFunc result for job id Q02763

User Input

>input (1124 residues)
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGEC
ICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIE
VNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKK
LLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTAS
IGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWT
ILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGS
SNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRR
MAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLK
ARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQF
IHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSD
VWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPY
ERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O73791	0.277	0.279	0.000	1116	0.523	0.527	O73791.pdb.gz	TIE2_DANRE Tyrosine-protein kinase receptor Tie-2 OS=Danio rerio OX=7955 GN=tie2 PE=2 SV=1
2	AFDB:P35590	0.442	0.437	0.000	1138	0.459	0.453	P35590.pdb.gz	TIE1_HUMAN Tyrosine-protein kinase receptor Tie-1 OS=Homo sapiens OX=9606 GN=TIE1 PE=1 SV=1
3	AFDB:Q02763	1.000	1.000	0.000	1124	1.000	1.000	Q02763.pdb.gz	TIE2_HUMAN Angiopoietin-1 receptor OS=Homo sapiens OX=9606 GN=TEK PE=1 SV=2
4	AFDB:P30530	0.244	0.306	1.695E-53	894	0.183	0.230	P30530.pdb.gz	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
5	AFDB:Q00993	0.235	0.297	2.083E-53	888	0.182	0.231	Q00993.pdb.gz	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
6	AFDB:E9PSX9	0.237	0.301	1.911E-52	879	0.185	0.237	E9PSX9.pdb.gz	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
7	AFDB:Q06418	0.243	0.304	7.686E-52	890	0.171	0.216	Q06418.pdb.gz	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
8	AFDB:E9PSY0	0.238	0.300	1.944E-51	888	0.184	0.233	E9PSY0.pdb.gz	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
9	AFDB:Q12866	0.236	0.265	1.378E-50	999	0.167	0.188	Q12866.pdb.gz	MERTK_HUMAN Tyrosine-protein kinase Mer OS=Homo sapiens OX=9606 GN=MERTK PE=1 SV=2
10	AFDB:P57097	0.235	0.265	1.877E-50	994	0.174	0.197	P57097.pdb.gz	MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus OX=10116 GN=Mertk PE=2 SV=1
11	PDB:1k9aB	0.216	0.538	7.211E-22	441	0.088	0.224	1k9aB.pdb.gz
12	PDB:2h8hA	0.210	0.509	7.457E-20	445	0.098	0.247	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.217	0.428	1.145E-18	555	0.085	0.171	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.219	0.436	1.950E-17	551	0.081	0.165	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.193	0.693	4.297E-16	283	0.067	0.265	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:1e07A	0.149	0.221	1.559E-15	642	0.060	0.106	1e07A.pdb.gz
17	PDB:3pfqA	0.210	0.434	1.819E-15	523	0.072	0.155	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
18	PDB:2bujA	0.211	0.753	2.610E-15	291	0.058	0.223	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
19	PDB:2qkwB	0.211	0.742	3.377E-15	292	0.070	0.271	2qkwB.pdb.gz
20	PDB:6s73A	0.215	0.827	3.556E-15	269	0.053	0.223	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZW61	0.0	2091	1121	0.913	0.915	A0A8I5ZW61_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Tek PE=1 SV=1
2	A0A8I6G914	0.0	2024	1069	0.887	0.933	A0A8I6G914_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Tek PE=1 SV=1
3	B5DFD6	0.0	969	1137	0.478	0.472	B5DFD6_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Tie1 PE=2 SV=1
4	D3ZCD0	0.0	2154	1120	0.932	0.936	D3ZCD0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Tek PE=4 SV=1
5	O73791	0.0	1110	1116	0.529	0.533	TIE2_DANRE Tyrosine-protein kinase receptor Tie-2 OS=Danio rerio OX=7955 GN=tie2 PE=2 SV=1
6	P35590	0.0	954	1138	0.471	0.465	TIE1_HUMAN Tyrosine-protein kinase receptor Tie-1 OS=Homo sapiens OX=9606 GN=TIE1 PE=1 SV=1
7	Q02763	0.0	2351	1124	1.000	1.000	TIE2_HUMAN Angiopoietin-1 receptor OS=Homo sapiens OX=9606 GN=TEK PE=1 SV=2
8	Q02858	0.0	2153	1122	0.928	0.930	TIE2_MOUSE Angiopoietin-1 receptor OS=Mus musculus OX=10090 GN=Tek PE=1 SV=2
9	Q06806	0.0	942	1134	0.473	0.469	TIE1_MOUSE Tyrosine-protein kinase receptor Tie-1 OS=Mus musculus OX=10090 GN=Tie1 PE=1 SV=3
10	O73792	8.00e-107	333	184	0.138	0.842	TIE1_DANRE Tyrosine-protein kinase receptor Tie-1 (Fragment) OS=Danio rerio OX=7955 GN=tie1 PE=2 SV=1
11	A0A8I5Y7R6	5.79e-72	258	782	0.122	0.175	A0A8I5Y7R6_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=3 SV=1
12	Q9JHX9	6.29e-72	258	800	0.122	0.171	Q9JHX9_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=2 SV=1
13	F1LSN4	6.71e-72	258	801	0.122	0.171	F1LSN4_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=3
14	P22607	7.08e-72	258	806	0.122	0.170	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
15	A0A0G2K210	8.90e-72	258	803	0.122	0.171	A0A0G2K210_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=2
16	F1LN06	8.51e-71	253	726	0.114	0.176	F1LN06_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
17	F1LRU8	9.62e-71	254	752	0.114	0.170	F1LRU8_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr2 PE=3 SV=1
18	Q498D6	1.55e-70	254	800	0.118	0.166	FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1
19	P21802	2.80e-70	254	821	0.114	0.156	FGFR2_HUMAN Fibroblast growth factor receptor 2 OS=Homo sapiens OX=9606 GN=FGFR2 PE=1 SV=1
20	P21803	2.80e-70	254	821	0.114	0.156	FGFR2_MOUSE Fibroblast growth factor receptor 2 OS=Mus musculus OX=10090 GN=Fgfr2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	2.4	19.5	Phosphotransferase enzyme family
2	PF15774 DUF4702	3.7e+02	11.4	Domain of unknown function (DUF4702)
3	PF07974 EGF_2	3.9	19.2	EGF-like domain
4	PF00041 fn3	3e-34	128.5	Fibronectin type III domain
5	PF16893 fn3_2	4.9	18.7	Fibronectin type III domain
6	PF12330 Haspin_kinase	5.4e+02	10.9	Haspin like kinase domain
7	PF12661 hEGF	6	18.9	Human growth factor-like EGF
8	PF10430 Ig_Tie2_1	4.3e-41	150.5	Tie-2 Ig-like domain 1
9	PF09294 Interfer-bind	5.7	18.6	Interferon-alpha/beta receptor, fibronectin type III
10	PF00053 Laminin_EGF	48	15.5	Laminin EGF domain
11	PF10179 NDNF	5.6e+02	12.0	Neuron-derived neurotrophic factor, first Fn(III) domain
12	PF00069 Pkinase	8.7e-41	151.6	Protein kinase domain
13	PF17667 Pkinase_fungal	3.3e+02	11.4	Fungal protein kinase
14	PF07714 PK_Tyr_Ser-Thr	2.4e-88	307.3	Protein tyrosine and serine/threonine kinase
15	PF16656 Pur_ac_phosph_N	3.1e-05	35.9	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314897	0.999	Angiopoietin-2
2	9606.ENSP00000428340	0.999	Angiopoietin-1
3	9606.ENSP00000371347	0.993	Angiopoietin-4
4	9606.ENSP00000478570	0.989	Vascular endothelial growth factor A
5	9606.ENSP00000401303	0.985	SHC-transforming protein 1
6	9606.ENSP00000276420	0.984	Docking protein 2
7	9606.ENSP00000428056	0.974	Phosphatidylinositol 3-kinase regulatory subunit alpha
8	9606.ENSP00000376345	0.973	Growth factor receptor-bound protein 2
9	9606.ENSP00000403459	0.971	Growth factor receptor-bound protein 7
10	9606.ENSP00000417273	0.967	Cytoplasmic protein NCK1
11	9606.ENSP00000321203	0.966	TNFAIP3-interacting protein 2
12	9606.ENSP00000340944	0.965	Tyrosine-protein phosphatase non-receptor type 11
13	9606.ENSP00000341208	0.957	Signal transducer and activator of transcription 5A
14	9606.ENSP00000219070	0.952	72 kDa type IV collagenase
15	9606.ENSP00000379350	0.945	Integrin beta-1
16	9606.ENSP00000308938	0.940	Plasminogen
17	9606.ENSP00000263915	0.938	Growth factor receptor-bound protein 14
18	9606.ENSP00000293328	0.938	Signal transducer and activator of transcription 5B
19	9606.ENSP00000256078	0.937	GTPase KRas
20	9606.ENSP00000407586	0.937	GTPase HRas

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0038023	0.996	signaling receptor activity
GO:0019838	0.986	growth factor binding
GO:0004888	0.981	transmembrane signaling receptor activity
GO:0019199	0.960	transmembrane receptor protein kinase activity
GO:0042802	0.924	identical protein binding
GO:0004714	0.886	transmembrane receptor protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0045765	0.992	regulation of angiogenesis
GO:0032501	0.990	multicellular organismal process
GO:0048856	0.989	anatomical structure development
GO:0007166	0.988	cell surface receptor signaling pathway
GO:0051240	0.987	positive regulation of multicellular organismal process
GO:0035295	0.984	tube development
GO:0001944	0.982	vasculature development
GO:0045766	0.979	positive regulation of angiogenesis
GO:0042221	0.965	response to chemical
GO:0048513	0.964	animal organ development
GO:0007169	0.959	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0019222	0.957	regulation of metabolic process
GO:0001570	0.957	vasculogenesis
GO:0010033	0.947	response to organic substance
GO:0048519	0.936	negative regulation of biological process
GO:0048583	0.907	regulation of response to stimulus
GO:0036075	0.907	replacement ossification
GO:0031323	0.897	regulation of cellular metabolic process
GO:0009719	0.893	response to endogenous stimulus
GO:0060348	0.890	bone development
GO:0010243	0.875	response to organonitrogen compound
GO:1901700	0.870	response to oxygen-containing compound
GO:0010646	0.861	regulation of cell communication
GO:0023051	0.848	regulation of signaling
GO:0048584	0.845	positive regulation of response to stimulus
GO:0019220	0.836	regulation of phosphate metabolic process
GO:1901652	0.833	response to peptide
GO:0009966	0.825	regulation of signal transduction
GO:0042127	0.824	regulation of cell population proliferation
GO:0042325	0.823	regulation of phosphorylation
GO:0048522	0.821	positive regulation of cellular process
GO:0010647	0.813	positive regulation of cell communication
GO:0008152	0.800	metabolic process
GO:0009887	0.798	animal organ morphogenesis
GO:0030334	0.798	regulation of cell migration
GO:0023056	0.788	positive regulation of signaling
GO:0010632	0.779	regulation of epithelial cell migration
GO:0060350	0.774	endochondral bone morphogenesis
GO:0010594	0.772	regulation of endothelial cell migration
GO:0042981	0.771	regulation of apoptotic process
GO:0006950	0.766	response to stress
GO:0001958	0.751	endochondral ossification
GO:0060255	0.746	regulation of macromolecule metabolic process
GO:0043434	0.739	response to peptide hormone
GO:2000147	0.728	positive regulation of cell motility
GO:0030335	0.723	positive regulation of cell migration
GO:0048523	0.721	negative regulation of cellular process
GO:0009893	0.699	positive regulation of metabolic process
GO:0051171	0.691	regulation of nitrogen compound metabolic process
GO:0009628	0.690	response to abiotic stimulus
GO:0080090	0.688	regulation of primary metabolic process
GO:0043627	0.684	response to estrogen
GO:0051591	0.655	response to cAMP
GO:0009967	0.653	positive regulation of signal transduction
GO:0008284	0.615	positive regulation of cell population proliferation
GO:0065009	0.609	regulation of molecular function
GO:0070482	0.604	response to oxygen levels
GO:1902531	0.588	regulation of intracellular signal transduction
GO:0071704	0.586	organic substance metabolic process
GO:0010604	0.581	positive regulation of macromolecule metabolic process
GO:0036293	0.567	response to decreased oxygen levels
GO:0001666	0.552	response to hypoxia
GO:1902533	0.528	positive regulation of intracellular signal transduction
GO:0048646	0.515	anatomical structure formation involved in morphogenesis
GO:0050790	0.508	regulation of catalytic activity
GO:0031325	0.496	positive regulation of cellular metabolic process
GO:0051128	0.488	regulation of cellular component organization
GO:0001934	0.482	positive regulation of protein phosphorylation
GO:1904035	0.481	regulation of epithelial cell apoptotic process
GO:0010468	0.474	regulation of gene expression
GO:0044237	0.437	cellular metabolic process
GO:0044238	0.413	primary metabolic process
GO:0050678	0.381	regulation of epithelial cell proliferation
GO:0051241	0.380	negative regulation of multicellular organismal process
GO:0006807	0.336	nitrogen compound metabolic process
GO:0001936	0.326	regulation of endothelial cell proliferation
GO:0044093	0.321	positive regulation of molecular function
GO:0070887	0.305	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.998	intracellular anatomical structure
GO:0043226	0.961	organelle
GO:0043229	0.949	intracellular organelle
GO:0005737	0.947	cytoplasm
GO:0043231	0.798	intracellular membrane-bounded organelle
GO:0005576	0.737	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.886	receptor protein-tyrosine kinase.

[back to server]