StarFunc result for job id Q02779

User Input

>input (954 residues)
MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWT
GQLPSGRVGVFPSNYVAPGAPAAPAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGE
EVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLA
DTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLR
RREQELAEREMDIVERELHLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGF
EHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSR
GGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHT
PIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVPLPAEPSPGARAPWEPTPSAPP
ARWGHGARRRCDLALLGCATLLGAVGLGADVAEARAADGEEQRRWLDGLFFPRAGRFPRG
LSPPARPHGRREDVGPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPAAPSPPPSP
PAPTPTPSPSTNPLVDLELESFKKDPRQSLTPTHVTAACAVSRGHRRTPSDGALGQRGPP
EPAGHGPGPRDLLDFPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWK
LVSFGRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02779	1.000	1.000	0.000	954	1.000	1.000	Q02779.pdb.gz	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
2	AFDB:Q7T2V3	0.448	0.428	9.307E-92	1005	0.633	0.601	Q7T2V3.pdb.gz	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
3	AFDB:Q95UN8	0.427	0.355	3.893E-55	1161	0.362	0.297	Q95UN8.pdb.gz	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
4	AFDB:A0A0K3AV08	0.284	0.258	1.539E-28	1059	0.226	0.204	A0A0K3AV08.pdb.gz	MLK1_CAEEL Mitogen-activated protein kinase kinase kinase mlk-1 OS=Caenorhabditis elegans OX=6239 GN=mlk-1 PE=1 SV=1
5	AFDB:F7BN18	0.253	0.216	1.171E-22	1128	0.223	0.189	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
6	AFDB:A0A024R8E2	0.255	0.217	2.974E-22	1130	0.211	0.178	A0A024R8E2.pdb.gz
7	AFDB:E9PT20	0.253	0.213	5.742E-22	1143	0.218	0.182	E9PT20.pdb.gz	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
8	PDB:2h8hA	0.252	0.523	2.944E-21	445	0.127	0.272	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
9	PDB:1k9aB	0.247	0.519	2.639E-20	441	0.116	0.252	1k9aB.pdb.gz
10	PDB:4k2rA	0.249	0.422	1.098E-18	551	0.100	0.172	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
11	PDB:4fl2A	0.245	0.411	2.366E-18	555	0.105	0.180	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
12	AFDB:A0A0R4IEP9	0.247	0.182	3.707E-16	1332	0.190	0.136	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
13	AFDB:Q9W002	0.255	0.166	3.916E-16	1504	0.175	0.111	Q9W002.pdb.gz	Q9W002_DROME Misshapen, isoform A OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=3
14	PDB:7mfdA	0.253	0.563	4.325E-16	410	0.103	0.239	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
15	PDB:4btfA	0.243	0.528	6.707E-16	413	0.069	0.160	4btfA.pdb.gz
16	AFDB:Q8IWU2	0.246	0.161	1.110E-15	1503	0.178	0.113	Q8IWU2.pdb.gz	LMTK2_HUMAN Serine/threonine-protein kinase LMTK2 OS=Homo sapiens OX=9606 GN=LMTK2 PE=1 SV=2
17	PDB:6lk5A	0.239	0.778	1.160E-15	265	0.071	0.257	6lk5A.pdb.gz
18	PDB:6s73A	0.235	0.777	2.641E-15	269	0.080	0.283	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
19	PDB:7lhwA	0.240	0.131	9.846E-15	1813	0.103	0.054	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
20	PDB:3uc4A	0.230	0.668	4.828E-14	295	0.083	0.268	3uc4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUN9	0.0	966	1078	0.613	0.543	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
2	D3ZG83	0.0	1642	940	0.904	0.917	M3K10_RAT Mitogen-activated protein kinase kinase kinase 10 OS=Rattus norvegicus OX=10116 GN=Map3k10 PE=1 SV=3
3	F1LRA7	0.0	957	1100	0.613	0.532	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
4	P80192	0.0	933	1104	0.597	0.516	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
5	Q02779	0.0	1913	954	1.000	1.000	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
6	Q16584	0.0	676	847	0.396	0.446	M3K11_HUMAN Mitogen-activated protein kinase kinase kinase 11 OS=Homo sapiens OX=9606 GN=MAP3K11 PE=1 SV=1
7	Q5TCX8	0.0	722	1036	0.498	0.458	M3K21_HUMAN Mitogen-activated protein kinase kinase kinase 21 OS=Homo sapiens OX=9606 GN=MAP3K21 PE=1 SV=3
8	Q66HA1	0.0	674	850	0.369	0.414	M3K11_RAT Mitogen-activated protein kinase kinase kinase 11 OS=Rattus norvegicus OX=10116 GN=Map3k11 PE=1 SV=1
9	Q66L42	0.0	1644	940	0.905	0.918	M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus OX=10090 GN=Map3k10 PE=1 SV=2
10	Q7T2V3	0.0	1097	1005	0.635	0.603	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
11	Q80XI6	0.0	676	850	0.370	0.415	M3K11_MOUSE Mitogen-activated protein kinase kinase kinase 11 OS=Mus musculus OX=10090 GN=Map3k11 PE=1 SV=1
12	Q95UN8	6.44e-169	526	1161	0.310	0.255	M3KSL_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=slpr PE=1 SV=1
13	Q12852	2.24e-76	270	859	0.157	0.175	M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens OX=9606 GN=MAP3K12 PE=1 SV=2
14	Q60700	3.86e-76	270	888	0.157	0.169	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
15	Q1HKZ5	1.18e-71	258	959	0.169	0.168	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
16	O43283	1.24e-70	255	966	0.153	0.151	M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens OX=9606 GN=MAP3K13 PE=1 SV=1
17	D4Q8H0	6.47e-67	233	455	0.145	0.303	D4Q8H0_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=pk PE=1 SV=1
18	Q9VW24	3.44e-65	239	977	0.146	0.142	Q9VW24_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1
19	Q9NYL2	4.11e-65	236	800	0.144	0.171	M3K20_HUMAN Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 PE=1 SV=3
20	D3DMF6	4.12e-65	239	950	0.146	0.146	D3DMF6_DROME Mitogen-activated protein kinase kinase kinase OS=Drosophila melanogaster OX=7227 GN=wnd PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	5.4e-54	194.9	Protein kinase domain
2	PF17667 Pkinase_fungal	45	14.3	Fungal protein kinase
3	PF07714 PK_Tyr_Ser-Thr	4.1e-58	208.3	Protein tyrosine and serine/threonine kinase
4	PF12072 RNase_Y_N	4.1e+02	11.8	RNase Y N-terminal region
5	PF00018 SH3_1	1.5e-07	42.2	SH3 domain
6	PF07653 SH3_2	2.3e-07	41.9	Variant SH3 domain
7	PF14604 SH3_9	5.9e-11	53.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253055

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345083	0.929	Dual specificity mitogen-activated protein kinase kinase 3
2	9606.ENSP00000468348	0.922	Dual specificity mitogen-activated protein kinase kinase 6
3	9606.ENSP00000385808	0.882	Kinesin-like protein KIF3A
4	9606.ENSP00000381070	0.880	Dual specificity mitogen-activated protein kinase kinase 7
5	9606.ENSP00000347184	0.870	Huntingtin
6	9606.ENSP00000330572	0.832	C-Jun-amino-terminal kinase-interacting protein 2
7	9606.ENSP00000241014	0.757	C-Jun-amino-terminal kinase-interacting protein 1
8	9606.ENSP00000382428	0.737	Disks large homolog 4
9	9606.ENSP00000247986	0.699	Kinesin-like protein KIF17
10	9606.ENSP00000362566	0.690	Neuron-specific calcium-binding protein hippocalcin
11	9606.ENSP00000383118	0.611	Cell division control protein 42 homolog
12	9606.ENSP00000302913	0.593	SH3 domain-containing protein 19
13	9606.ENSP00000394051	0.584	Nostrin
14	9606.ENSP00000360266	0.533	Transcription factor AP-1
15	9606.ENSP00000317332	0.519	Sorting nexin-18
16	9606.ENSP00000394560	0.503	Mitogen-activated protein kinase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004672	0.999	protein kinase activity
GO:0004674	0.980	protein serine/threonine kinase activity
GO:0008134	0.633	transcription factor binding
GO:0140297	0.622	DNA-binding transcription factor binding
GO:0043425	0.536	bHLH transcription factor binding
GO:0019899	0.457	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0008152	0.982	metabolic process
GO:0048518	0.975	positive regulation of biological process
GO:0050896	0.974	response to stimulus
GO:0044237	0.974	cellular metabolic process
GO:0048522	0.971	positive regulation of cellular process
GO:0071704	0.969	organic substance metabolic process
GO:0043170	0.959	macromolecule metabolic process
GO:0044238	0.958	primary metabolic process
GO:0006807	0.956	nitrogen compound metabolic process
GO:0019222	0.954	regulation of metabolic process
GO:0036211	0.945	protein modification process
GO:0006468	0.932	protein phosphorylation
GO:0051171	0.927	regulation of nitrogen compound metabolic process
GO:0060255	0.926	regulation of macromolecule metabolic process
GO:0080090	0.924	regulation of primary metabolic process
GO:0031323	0.923	regulation of cellular metabolic process
GO:0043408	0.890	regulation of MAPK cascade
GO:0007165	0.845	signal transduction
GO:0048519	0.809	negative regulation of biological process
GO:0010468	0.806	regulation of gene expression
GO:0035556	0.797	intracellular signal transduction
GO:0019219	0.796	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.788	negative regulation of cellular process
GO:0042981	0.750	regulation of apoptotic process
GO:0031326	0.741	regulation of cellular biosynthetic process
GO:0010556	0.734	regulation of macromolecule biosynthetic process
GO:0000165	0.732	MAPK cascade
GO:0065009	0.716	regulation of molecular function
GO:0043065	0.697	positive regulation of apoptotic process
GO:0009893	0.681	positive regulation of metabolic process
GO:0051246	0.667	regulation of protein metabolic process
GO:0006950	0.657	response to stress
GO:0010604	0.646	positive regulation of macromolecule metabolic process
GO:0050790	0.642	regulation of catalytic activity
GO:0031325	0.635	positive regulation of cellular metabolic process
GO:0045859	0.627	regulation of protein kinase activity
GO:0033554	0.625	cellular response to stress
GO:0031324	0.599	negative regulation of cellular metabolic process
GO:0051173	0.555	positive regulation of nitrogen compound metabolic process
GO:0048584	0.549	positive regulation of response to stimulus
GO:0051252	0.521	regulation of RNA metabolic process
GO:0010605	0.508	negative regulation of macromolecule metabolic process
GO:0051403	0.499	stress-activated MAPK cascade
GO:0008219	0.486	cell death
GO:0006355	0.482	regulation of DNA-templated transcription
GO:0044093	0.464	positive regulation of molecular function
GO:0023056	0.436	positive regulation of signaling
GO:0010647	0.436	positive regulation of cell communication
GO:0009967	0.431	positive regulation of signal transduction
GO:0043085	0.393	positive regulation of catalytic activity
GO:0051172	0.389	negative regulation of nitrogen compound metabolic process
GO:0080134	0.378	regulation of response to stress
GO:0043410	0.375	positive regulation of MAPK cascade
GO:0007166	0.326	cell surface receptor signaling pathway
GO:0032872	0.316	regulation of stress-activated MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.974	cytosol
GO:0016020	0.895	membrane
GO:0043226	0.869	organelle
GO:0043229	0.808	intracellular organelle
GO:0043227	0.661	membrane-bounded organelle
GO:0043231	0.624	intracellular membrane-bounded organelle
GO:0005886	0.388	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]