StarFunc result for job id Q02809

User Input

>input (727 residues)
MRPLLLLALLGWLLLAEAKGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGL
GEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELLKKFRQA
RSQVVFSAEELIYPDRRLETKYPVVSDGKRFLGSGGFIGYAPNLSKLVAEWEGQDSDSDQ
LFYTKIFLDPEKREQINITLDHRCRIFQNLDGALDEVVLKFEMGHVRARNLAYDTLPVLI
HGNGPTKLQLNYLGNYIPRFWTFETGCTVCDEGLRSLKGIGDEALPTVLVGVFIEQPTPF
VSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANAD
ARNMGADLCRQDRSCTYYFSVDADVALTEPNSLRLLIQQNKNVIAPLMTRHGRLWSNFWG
ALSADGYYARSEDYVDIVQGRRVGVWNVPYISNIYLIKGSALRGELQSSDLFHHSKLDPD
MAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYT
KALAGKLVETPCPDVYWFPIFTEVACDELVEEMEHFGQWSLGNNKDNRIQGGYENVPTID
IHMNQIGFEREWHKFLLEYIAPMTEKLYPGYYTRAQFDLAFVVRYKPDEQPSLMPHHDAS
TFTINIALNRVGVDYEGGGCRFLRYNCSIRAPRKGWTLMHPGRLTHYHEGLPTTRGTRYI
AVSFVDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6fxrA	0.920	0.955	0.000	700	0.574	0.596	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
2	AFDB:A0A2R8QKS4	0.951	0.947	0.000	730	0.597	0.595	A0A2R8QKS4.pdb.gz
3	AFDB:A0JMD1	0.945	0.941	0.000	730	0.673	0.670	A0JMD1.pdb.gz
4	AFDB:A4U7F8	0.950	0.942	0.000	733	0.575	0.570	A4U7F8.pdb.gz	A4U7F8_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
5	AFDB:A4U7F9	0.947	0.913	0.000	754	0.568	0.548	A4U7F9.pdb.gz	A4U7F9_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
6	AFDB:O00469	0.945	0.933	0.000	737	0.589	0.581	O00469.pdb.gz	PLOD2_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2
7	AFDB:Q5U367	0.945	0.927	0.000	741	0.586	0.575	Q5U367.pdb.gz	PLOD3_RAT Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Rattus norvegicus OX=10116 GN=Plod3 PE=1 SV=1
8	AFDB:Q63321	0.969	0.968	0.000	728	0.911	0.909	Q63321.pdb.gz	PLOD1_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Rattus norvegicus OX=10116 GN=Plod1 PE=1 SV=1
9	AFDB:Q9VTH0	0.930	0.937	0.000	721	0.425	0.429	Q9VTH0.pdb.gz	PLOD_DROME Procollagen-lysine,2-oxoglutarate 5-dioxygenase OS=Drosophila melanogaster OX=7227 GN=Plod PE=1 SV=1
10	AFDB:Q20679	0.915	0.911	8.153E-101	730	0.436	0.434	Q20679.pdb.gz	PLOD_CAEEL Multifunctional procollagen lysine hydroxylase and glycosyltransferase OS=Caenorhabditis elegans OX=6239 GN=let-268 PE=1 SV=1
11	AFDB:Q8NBJ5	0.281	0.327	3.828E-19	622	0.087	0.101	Q8NBJ5.pdb.gz	GT251_HUMAN Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
12	PDB:6iwqA	0.229	0.295	2.916E-6	546	0.050	0.066	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
13	PDB:7x8kB	0.172	0.304	1.039E-5	367	0.039	0.076	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
14	PDB:4d0tA	0.250	0.348	1.324E-5	496	0.052	0.077	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
15	PDB:2d7iA	0.232	0.304	1.495E-5	536	0.045	0.062	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
16	PDB:6h0bB	0.229	0.305	1.792E-5	521	0.058	0.081	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
17	PDB:3kt4A	0.213	0.268	2.023E-5	563	0.030	0.039	3kt4A.pdb.gz	Crystal structure of Tpa1 from Saccharomyces cerevisiae, a component of the messenger ribonucleoprotein complex
18	PDB:4d11C	0.229	0.358	2.023E-5	436	0.055	0.092	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
19	PDB:3mguA	0.210	0.280	2.149E-5	533	0.030	0.041	3mguA.pdb.gz	Structural and functional insights into S. cerevisiae Tpa1, a putative prolyl hydroxylase influencing translation termination and transcription
20	PDB:4xaeA	0.185	0.355	2.283E-5	329	0.044	0.097	4xaeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KNH4	0.0	957	730	0.597	0.595	A3KNH4_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=cb479 PE=1 SV=1
2	A4U7F8	0.0	916	733	0.576	0.572	A4U7F8_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
3	A4U7F9	0.0	905	754	0.578	0.557	A4U7F9_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=lh2 PE=1 SV=1
4	A8WIN7	0.0	1053	730	0.663	0.660	A8WIN7_DANRE procollagen-lysine 5-dioxygenase OS=Danio rerio OX=7955 GN=fc95g08 PE=1 SV=1
5	O00469	0.0	946	737	0.590	0.582	PLOD2_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2
6	O60568	0.0	918	738	0.578	0.569	PLOD3_HUMAN Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1
7	Q02809	0.0	1519	727	1.000	1.000	PLOD1_HUMAN Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Homo sapiens OX=9606 GN=PLOD1 PE=1 SV=2
8	Q20679	0.0	647	730	0.448	0.447	PLOD_CAEEL Multifunctional procollagen lysine hydroxylase and glycosyltransferase OS=Caenorhabditis elegans OX=6239 GN=let-268 PE=1 SV=1
9	Q5U367	0.0	933	741	0.583	0.572	PLOD3_RAT Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Rattus norvegicus OX=10116 GN=Plod3 PE=1 SV=1
10	Q63321	0.0	1362	728	0.893	0.891	PLOD1_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Rattus norvegicus OX=10116 GN=Plod1 PE=1 SV=1
11	Q811A3	0.0	946	737	0.598	0.590	PLOD2_RAT Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Rattus norvegicus OX=10116 GN=Plod2 PE=2 SV=1
12	Q9R0E1	0.0	932	741	0.583	0.572	PLOD3_MOUSE Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Mus musculus OX=10090 GN=Plod3 PE=1 SV=1
13	Q9R0E2	0.0	1348	728	0.897	0.896	PLOD1_MOUSE Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 OS=Mus musculus OX=10090 GN=Plod1 PE=1 SV=1
14	Q9VTH0	0.0	645	721	0.435	0.438	PLOD_DROME Procollagen-lysine,2-oxoglutarate 5-dioxygenase OS=Drosophila melanogaster OX=7227 GN=Plod PE=1 SV=1
15	Q8IYK4	8.76e-19	93.2	626	0.096	0.112	GT252_HUMAN Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
16	Q8NBJ5	7.87e-13	74.3	622	0.087	0.101	GT251_HUMAN Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
17	Q5T4B2	2.81e-11	69.3	595	0.089	0.109	GT253_HUMAN Inactive glycosyltransferase 25 family member 3 OS=Homo sapiens OX=9606 GN=CERCAM PE=1 SV=1
18	Q6N063	1.68e-08	59.3	350	0.054	0.111	OGFD2_HUMAN 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=OGFOD2 PE=1 SV=2
19	Q3ED68	1.89e-05	50.1	397	0.058	0.106	ICU11_ARATH 2-oxoglutarate and iron-dependent oxygenase domain-containing protein ICU11 OS=Arabidopsis thaliana OX=3702 GN=ICU11 PE=2 SV=2
20	P0DO23	0.006	42.0	394	0.069	0.127	CP2_ARATH 2-oxoglutarate and iron-dependent oxygenase domain-containing protein CP2 OS=Arabidopsis thaliana OX=3702 GN=CP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03171 2OG-FeII_Oxy	0.0051	28.6	2OG-Fe(II) oxygenase superfamily
2	PF13640 2OG-FeII_Oxy_3	1.3	21.3	2OG-Fe(II) oxygenase superfamily
3	PF03452 Anp1	0.0067	27.5	Anp1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000196061

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252599	0.950	Procollagen galactosyltransferase 1
2	9606.ENSP00000354960	0.923	Procollagen galactosyltransferase 2
3	9606.ENSP00000223127	0.917	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
4	9606.ENSP00000282903	0.912	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
5	9606.ENSP00000364000	0.901	Collagen alpha-2(V) chain
6	9606.ENSP00000367755	0.900	Calmodulin-lysine N-methyltransferase
7	9606.ENSP00000360882	0.872	Collagen alpha-1(V) chain
8	9606.ENSP00000225964	0.845	Collagen alpha-1(I) chain
9	9606.ENSP00000304408	0.839	Collagen alpha-1(III) chain
10	9606.ENSP00000323696	0.829	Cartilage-associated protein
11	9606.ENSP00000384999	0.816	Prolyl 4-hydroxylase subunit alpha-2
12	9606.ENSP00000297268	0.803	Collagen alpha-2(I) chain
13	9606.ENSP00000236040	0.800	Prolyl 3-hydroxylase 1
14	9606.ENSP00000395929	0.795	Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific
15	9606.ENSP00000263556	0.785	Prolyl 4-hydroxylase subunit alpha-1
16	9606.ENSP00000384629	0.785	N-lysine methyltransferase KMT5A
17	9606.ENSP00000359114	0.779	Collagen alpha-1(XI) chain
18	9606.ENSP00000364979	0.771	Collagen alpha-1(IV) chain
19	9606.ENSP00000325146	0.764	Collagen alpha-1(XII) chain
20	9606.ENSP00000331902	0.763	Collagen alpha-5(IV) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008475	0.999	procollagen-lysine 5-dioxygenase activity
GO:0005488	0.995	binding
GO:0005515	0.983	protein binding
GO:0016740	0.473	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0018126	0.990	protein hydroxylation
GO:0050896	0.986	response to stimulus
GO:0009987	0.983	cellular process
GO:0018193	0.958	peptidyl-amino acid modification
GO:0070482	0.929	response to oxygen levels
GO:0018205	0.868	peptidyl-lysine modification
GO:0032502	0.705	developmental process
GO:0048856	0.704	anatomical structure development
GO:0006950	0.613	response to stress
GO:0001666	0.410	response to hypoxia
GO:0032501	0.394	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0071944	0.997	cell periphery
GO:0005783	0.997	endoplasmic reticulum
GO:0016020	0.985	membrane
GO:0030312	0.978	external encapsulating structure
GO:0031012	0.965	extracellular matrix
GO:0032991	0.962	protein-containing complex
GO:0062023	0.960	collagen-containing extracellular matrix
GO:0031984	0.933	organelle subcompartment
GO:0031982	0.868	vesicle
GO:0031090	0.808	organelle membrane
GO:0043233	0.756	organelle lumen
GO:0043230	0.722	extracellular organelle
GO:1903561	0.713	extracellular vesicle
GO:0070062	0.696	extracellular exosome
GO:0070013	0.568	intracellular organelle lumen
GO:0042175	0.548	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.510	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16569	0.999	2-oxoglutarate + L-lysyl-[collagen] + O2 = (5R)-5-hydroxy-L-lysyl-[collagen] + CO2 + succinate
EC:1.14.11.4	0.999	procollagen-lysine 5-dioxygenase.
EC:2.-.-.-	0.473	Transferases.

[back to server]