StarFunc result for job id Q02817

User Input

>input (1400 residues)
MGLPLARLAAVCLALSLAGGSELQTEGRTRYHGRNVCSTWGNFHYKTFDGDVFRFPGLCD
YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP
HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV
YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNAVVFKSDGSVLLNQLQVNLPHVTA
SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
TASGLVEATGAGFANTWKAQSTCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR
CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGS
CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC
YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR
ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN
TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF
SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV
ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS
WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC
SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR
SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA
SVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITT
RPSTLTTFTTITLPTTPTSFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDD
GDREPFDGVCGAPEDIECRSVKDPHLSLEQHGQKVQCDVSVGFICKNEDQFGNGPFGLCY
DYKIRVNCCWPMDKCITTPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K1Y4	0.463	0.582	0.000	1103	0.400	0.508	A0A0G2K1Y4.pdb.gz	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
2	AFDB:F1NBL0	0.445	0.521	0.000	1185	0.320	0.378	F1NBL0.pdb.gz	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
3	AFDB:Q6W4X9	0.455	0.269	0.000	2439	0.356	0.205	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
4	AFDB:Q80Z19	0.765	0.419	0.000	2680	0.792	0.414	Q80Z19.pdb.gz	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
5	AFDB:Q98UI9	0.468	0.316	0.000	2108	0.372	0.247	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
6	AFDB:Q3ZCN5	0.434	0.279	5.411E-95	2332	0.261	0.157	Q3ZCN5.pdb.gz	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
7	AFDB:A0A286YAF1	0.383	0.267	5.087E-90	2146	0.264	0.172	A0A286YAF1.pdb.gz
8	AFDB:Q28983	0.221	0.128	1.264E-70	2476	0.204	0.115	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
9	AFDB:O08523	0.209	0.140	3.925E-69	2155	0.207	0.135	O08523.pdb.gz	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
10	AFDB:E9Q0B5	0.222	0.125	7.498E-69	2583	0.235	0.127	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
11	PDB:6z3mc	0.090	0.672	8.972E-5	158	0.016	0.146	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
12	PDB:7d5sBE	0.047	0.068	2.171E-3	865	0.044	0.071	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:7mq8LT	0.045	0.063	4.360E-3	869	0.051	0.082	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mq8LR	0.061	0.091	1.068E-2	773	0.036	0.065	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5lj5t	0.047	0.098	1.757E-2	438	0.036	0.116	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
16	PDB:7d5sB2	0.061	0.077	2.041E-2	851	0.036	0.060	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:6nd4H	0.045	0.064	2.145E-2	834	0.041	0.068	6nd4H.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
18	PDB:1kv9A	0.051	0.081	2.490E-2	664	0.035	0.074	1kv9A.pdb.gz	Structure at 1.9 A resolution of a quinohemoprotein alcohol dehydrogenase from Pseudomonas putida HK5.
19	PDB:6r8yK	0.037	0.052	3.039E-2	825	0.046	0.079	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
20	PDB:7dvq3	0.063	0.069	3.709E-2	1193	0.039	0.045	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1Y4	1290	3586	0.463	0.181	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
2	A0A0G2K8X5	1290	3922	0.463	0.165	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
3	E7F9Z1	689	2812	0.300	0.149	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3
4	E9PWB6	1296	2751	0.464	0.236	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
5	E9Q5I3	1313	4800	0.471	0.137	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
6	E9QAQ8	1304	3455	0.465	0.188	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
7	F1NBL0	802	1185	0.312	0.369	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
8	P04275	672	2813	0.302	0.150	VWF_HUMAN von Willebrand factor OS=Homo sapiens OX=9606 GN=VWF PE=1 SV=4
9	P98088	1367	5654	0.487	0.121	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
10	Q02817	3191	5179	1.000	0.270	MUC2_HUMAN Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=3
11	Q62635	2285	1513	0.779	0.720	MUC2_RAT Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1
12	Q6PZE0	720	7524	0.304	0.057	MUC19_MOUSE Mucin-19 OS=Mus musculus OX=10090 GN=Muc19 PE=2 SV=2
13	Q6W4X9	854	2439	0.338	0.194	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
14	Q7Z5P9	702	8384	0.307	0.051	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
15	Q80Z19	2291	2680	0.784	0.410	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
16	Q8BYW0	1301	1477	0.471	0.446	Q8BYW0_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
17	Q8CIZ8	671	2813	0.301	0.150	VWF_MOUSE von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2
18	Q8K1G6	1308	4782	0.470	0.138	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
19	Q98UI9	1032	2108	0.371	0.247	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
20	Q9ESP3	1292	1851	0.463	0.350	Q9ESP3_RAT Mucin (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08742 C8	1.3e-48	174.5	C8 domain
2	PF13330 Mucin2_WxxW	1e-15	69.6	Mucin-2 protein WxxW repeating region
3	PF05375 Pacifastin_I	0.86	20.7	Pacifastin inhibitor (LCMII)
4	PF01826 TIL	6.5e-09	47.2	Trypsin Inhibitor like cysteine rich domain
5	PF00093 VWC	0.016	26.8	von Willebrand factor type C domain
6	PF00094 VWD	1.7e-95	329.0	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008965539.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003805895.1	0.882	Mucin 4, cell surface associated
2	9597.XP_003809043.1	0.869	Mucin 7, secreted
3	9597.XP_008948772.1	0.837	Mucin 13, cell surface associated
4	9597.XP_003830491.1	0.832	Mucin 15, cell surface associated
5	9597.XP_008960178.1	0.815	Mucin 16, cell surface associated
6	9597.XP_008974020.1	0.793	Mucin 20, cell surface associated
7	9597.XP_003807251.2	0.778	Mucin 17, cell surface associated
8	9597.XP_003825035.1	0.703	Glycosyltransferase that generates the core 1 O-glycan Gal- beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins
9	9597.XP_003827202.1	0.703	Polypeptide N-acetylgalactosaminyltransferase 14
10	9597.XP_003817115.1	0.701	Mucin 1, cell surface associated
11	9597.XP_003823935.1	0.696	Trefoil factor 3
12	9597.XP_008960161.1	0.685	Mucin-16
13	9597.XP_003822530.1	0.677	alpha-1,4-N-acetylglucosaminyltransferase
14	9597.XP_003831735.1	0.661	Galectin 3
15	9597.XP_003808197.1	0.651	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6
16	9597.XP_003824367.1	0.632	Polypeptide N-acetylgalactosaminyltransferase 3
17	9597.XP_008961415.1	0.632	Polypeptide N-acetylgalactosaminyltransferase 6
18	9597.XP_003810510.1	0.631	Glucosaminyl (N-acetyl) transferase 4, core 2
19	9597.XP_003827954.1	0.631	Glucosaminyl (N-acetyl) transferase 3, mucin type
20	9597.XP_003826247.1	0.630	Polypeptide N-acetylgalactosaminyltransferase 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.986	response to stimulus
GO:0009987	0.920	cellular process
GO:0010038	0.906	response to metal ion
GO:0061687	0.744	detoxification of inorganic compound
GO:0046688	0.744	response to copper ion
GO:0097501	0.744	stress response to metal ion
GO:0032501	0.716	multicellular organismal process
GO:0060249	0.569	anatomical structure homeostasis
GO:0022600	0.528	digestive system process
GO:0001894	0.496	tissue homeostasis
GO:0050794	0.435	regulation of cellular process
GO:0030277	0.374	maintenance of gastrointestinal epithelium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005737	0.994	cytoplasm
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005886	0.988	plasma membrane
GO:0012505	0.985	endomembrane system
GO:0005576	0.947	extracellular region
GO:0030312	0.878	external encapsulating structure
GO:0031012	0.835	extracellular matrix
GO:0070013	0.813	intracellular organelle lumen
GO:0005794	0.766	Golgi apparatus
GO:0062023	0.756	collagen-containing extracellular matrix
GO:0005615	0.593	extracellular space
GO:0005634	0.402	nucleus
GO:0031981	0.325	nuclear lumen
GO:0005796	0.301	Golgi lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]