StarFunc result for job id Q02846

User Input

>input (1103 residues)
MTACARRAGGLPDPGLCGPAWWAPSLPRLPRALPRLPLLLLLLLLQPPALSAVFTVGVLG
PWACDPIFSRARPDLAARLAAARLNRDPGLAGGPRFEVALLPEPCRTPGSLGAVSSALAR
VSGLVGPVNPAACRPAELLAEEAGIALVPWGCPWTQAEGTTAPAVTPAADALYALLRAFG
WARVALVTAPQDLWVEAGRSLSTALRARGLPVASVTSMEPLDLSGAREALRKVRDGPRVT
AVIMVMHSVLLGGEEQRYLLEAAEELGLTDGSLVFLPFDTIHYALSPGPEALAALANSSQ
LRRAHDAVLTLTRHCPSEGSVLDSLRRAQERRELPSDLNLQQVSPLFGTIYDAVFLLARG
VAEARAAAGGRWVSGAAVARHIRDAQVPGFCGDLGGDEEPPFVLLDTDAAGDRLFATYML
DPARGSFLSAGTRMHFPRGGSAPGPDPSCWFDPNNICGGGLEPGLVFLGFLLVVGMGLAG
AFLAHYVRHRLLHMQMVSGPNKIILTVDDITFLHPHGGTSRKVAQGSRSSLGARSMSDIR
SGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFL
ARGAEGPAALWEGNLAVVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHR
GVAHGRLKSRNCIVDGRFVLKITDHGHGRLLEAQKVLPEPPRAEDQLWTAPELLRDPALE
RRGTLAGDVFSLAIIMQEVVCRSAPYAMLELTPEEVVQRVRSPPPLCRPLVSMDQAPVEC
ILLMKQCWAEQPELRPSMDHTFDLFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTE
ELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIE
VVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAV
GTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHV
NLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGRRGFNKPIPKPPDLQPGSSNHG
ISLQEIPPERRRKLEKARPGQFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0U1RPR8	0.649	0.643	0.000	1117	0.500	0.494	A0A0U1RPR8.pdb.gz	GUC2D_MOUSE Guanylate cyclase D OS=Mus musculus OX=10090 GN=Gucy2d PE=2 SV=1
2	AFDB:B3DHF2	0.589	0.587	0.000	1107	0.504	0.502	B3DHF2.pdb.gz	B3DHF2_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=2 SV=1
3	AFDB:P51840	0.742	0.739	0.000	1108	0.852	0.848	P51840.pdb.gz	GUC2E_RAT Retinal guanylyl cyclase 1 OS=Rattus norvegicus OX=10116 GN=Gucy2e PE=1 SV=1
4	AFDB:P51841	0.511	0.509	0.000	1108	0.502	0.500	P51841.pdb.gz	GUC2F_HUMAN Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606 GN=GUCY2F PE=1 SV=2
5	AFDB:P51842	0.372	0.370	0.000	1108	0.508	0.505	P51842.pdb.gz	GUC2F_RAT Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX=10116 GN=Gucy2f PE=1 SV=1
6	AFDB:P55203	0.812	0.807	0.000	1110	0.870	0.865	P55203.pdb.gz	GUC2D_BOVIN Retinal guanylyl cyclase 1 OS=Bos taurus OX=9913 GN=GUCY2D PE=1 SV=1
7	AFDB:Q02846	1.000	1.000	0.000	1103	1.000	1.000	Q02846.pdb.gz	GUC2D_HUMAN Retinal guanylyl cyclase 1 OS=Homo sapiens OX=9606 GN=GUCY2D PE=1 SV=2
8	AFDB:Q6TL19	0.418	0.419	1.467E-77	1100	0.326	0.327	Q6TL19.pdb.gz	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
9	AFDB:P55205	0.438	0.439	2.093E-77	1100	0.318	0.319	P55205.pdb.gz	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
10	AFDB:P16066	0.519	0.533	1.906E-75	1061	0.336	0.350	P16066.pdb.gz	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1
11	PDB:7d9rA	0.206	0.439	4.802E-19	502	0.089	0.195	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
12	PDB:6jt0A	0.193	0.378	4.468E-18	542	0.091	0.185	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
13	PDB:7d9tA	0.178	0.376	2.772E-17	512	0.087	0.188	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
14	PDB:7yziA	0.178	0.501	3.869E-16	378	0.082	0.238	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
15	PDB:6jt0B	0.200	0.368	5.804E-16	576	0.098	0.188	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
16	PDB:1z16A	0.234	0.638	4.017E-13	344	0.057	0.183	1z16A.pdb.gz	Ligand-free and -bound structures of the binding protein (LivJ) of the Escherichia coli ABC leucine/isoleucine/valine transport system: trajectory and dynamics of the interdomain rotation and ligand specificity.
17	PDB:6w2xB	0.255	0.388	1.579E-12	669	0.064	0.106	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
18	PDB:7c7sA	0.267	0.405	2.252E-12	685	0.053	0.085	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
19	PDB:4btfA	0.190	0.474	4.578E-12	413	0.044	0.116	4btfA.pdb.gz
20	PDB:5idfB	0.251	0.360	5.330E-12	734	0.045	0.068	5idfB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RPR8	0.0	1022	1117	0.500	0.494	GUC2D_MOUSE Guanylate cyclase D OS=Mus musculus OX=10090 GN=Gucy2d PE=2 SV=1
2	B3DHF2	0.0	1119	1107	0.509	0.507	B3DHF2_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=2 SV=1
3	F1QWF7	0.0	1134	1103	0.514	0.514	F1QWF7_DANRE Guanylate cyclase OS=Danio rerio OX=7955 GN=RETGC-1 PE=3 SV=2
4	O02740	0.0	1079	1103	0.501	0.501	GUC2F_BOVIN Retinal guanylyl cyclase 2 OS=Bos taurus OX=9913 GN=GUCY2F PE=1 SV=1
5	P51839	0.0	1008	1110	0.492	0.489	GUC2D_RAT Guanylate cyclase 2D OS=Rattus norvegicus OX=10116 GN=Gucy2d PE=1 SV=2
6	P51840	0.0	1865	1108	0.850	0.847	GUC2E_RAT Retinal guanylyl cyclase 1 OS=Rattus norvegicus OX=10116 GN=Gucy2e PE=1 SV=1
7	P51841	0.0	1069	1108	0.502	0.500	GUC2F_HUMAN Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606 GN=GUCY2F PE=1 SV=2
8	P51842	0.0	1087	1108	0.509	0.506	GUC2F_RAT Retinal guanylyl cyclase 2 OS=Rattus norvegicus OX=10116 GN=Gucy2f PE=1 SV=1
9	P52785	0.0	1843	1108	0.853	0.849	GUC2E_MOUSE Retinal guanylyl cyclase 1 OS=Mus musculus OX=10090 GN=Gucy2e PE=1 SV=2
10	P55203	0.0	1856	1110	0.868	0.862	GUC2D_BOVIN Retinal guanylyl cyclase 1 OS=Bos taurus OX=9913 GN=GUCY2D PE=1 SV=1
11	Q02846	0.0	2230	1103	1.000	1.000	GUC2D_HUMAN Retinal guanylyl cyclase 1 OS=Homo sapiens OX=9606 GN=GUCY2D PE=1 SV=2
12	Q5SDA5	0.0	1074	1108	0.505	0.503	GUC2F_MOUSE Retinal guanylyl cyclase 2 OS=Mus musculus OX=10090 GN=Gucy2f PE=1 SV=1
13	P55205	1.28e-158	501	1100	0.336	0.337	GUC2G_RAT Guanylate cyclase 2G OS=Rattus norvegicus OX=10116 GN=Gucy2g PE=2 SV=2
14	P18293	2.91e-158	499	1057	0.306	0.319	ANPRA_MOUSE Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2
15	P20594	3.74e-158	499	1047	0.308	0.325	ANPRB_HUMAN Atrial natriuretic peptide receptor 2 OS=Homo sapiens OX=9606 GN=NPR2 PE=1 SV=1
16	P16067	6.20e-158	498	1047	0.311	0.328	ANPRB_RAT Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1
17	Q6VVW5	1.12e-157	498	1047	0.309	0.326	ANPRB_MOUSE Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2
18	P18910	2.61e-157	497	1057	0.304	0.317	ANPRA_RAT Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1
19	Q6TL19	6.24e-154	489	1100	0.342	0.343	GUC2G_MOUSE Guanylate cyclase 2G OS=Mus musculus OX=10090 GN=Gucy2g PE=1 SV=1
20	P16066	1.03e-153	487	1061	0.337	0.351	ANPRA_HUMAN Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	1.8e-41	154.1	Receptor family ligand binding region
2	PF00211 Guanylate_cyc	7.9e-59	209.9	Adenylate and Guanylate cyclase catalytic domain
3	PF07701 HNOBA	0.018	26.0	Heme NO binding associated
4	PF14531 Kinase-like	62	14.4	Kinase-like
5	PF00069 Pkinase	1.4e-19	82.1	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	1.5e-23	95.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254854

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377784	0.999	Guanylyl cyclase-activating protein 1
2	9606.ENSP00000230361	0.995	Guanylyl cyclase-activating protein 2
3	9606.ENSP00000379256	0.981	Neurocalcin-delta
4	9606.ENSP00000251102	0.980	Cyclic nucleotide-gated cation channel beta-1
5	9606.ENSP00000261047	0.968	Guanylyl cyclase-activating protein 3
6	9606.ENSP00000291700	0.946	Protein S100-B
7	9606.ENSP00000316605	0.924	Cyclic nucleotide-gated cation channel beta-3
8	9606.ENSP00000355969	0.916	Plays a critical role in the regulation of enzymes involved in nucleotide cycle in photoreceptors (PubMed:29515371, PubMed:21928830, PubMed:21078983, PubMed:27471269, PubMed:30559291). Inhibits the basal catalytic activity and the GCAP-stimulated activity of GUCY2D and GUCY2F, two retinal guanylyl cyclases involved in the production of cGMP in photoreceptors (PubMed:21928830, PubMed:27471269, PubMed:29515371, PubMed:30559291). Involved in the transport of GUCY2D and GUCY2F to their target sites in the photoreceptor outer segment . Up-regulates the activity of GUK1, a kinase that plays [...]
9	9606.ENSP00000368455	0.901	Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
10	9606.ENSP00000369456	0.900	Inosine triphosphate pyrophosphatase
11	9606.ENSP00000255266	0.887	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
12	9606.ENSP00000370521	0.874	Aryl-hydrocarbon-interacting protein-like 1
13	9606.ENSP00000360502	0.864	Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
14	9606.ENSP00000420295	0.863	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
15	9606.ENSP00000334910	0.855	cGMP-dependent 3',5'-cyclic phosphodiesterase
16	9606.ENSP00000356370	0.827	Protein crumbs homolog 1
17	9606.ENSP00000266395	0.826	Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
18	9606.ENSP00000218006	0.809	Retinal guanylyl cyclase 2
19	9606.ENSP00000377140	0.807	Cyclic nucleotide-gated cation channel alpha-3
20	9606.ENSP00000221996	0.806	Cone-rod homeobox protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004383	1.000	guanylate cyclase activity
GO:0038023	0.795	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.995	biological regulation
GO:0050789	0.989	regulation of biological process
GO:0050794	0.979	regulation of cellular process
GO:0050896	0.973	response to stimulus
GO:0007154	0.961	cell communication
GO:0032501	0.954	multicellular organismal process
GO:0051716	0.945	cellular response to stimulus
GO:0023052	0.918	signaling
GO:0007165	0.911	signal transduction
GO:0071704	0.843	organic substance metabolic process
GO:0044237	0.836	cellular metabolic process
GO:0006807	0.802	nitrogen compound metabolic process
GO:0044238	0.744	primary metabolic process
GO:0050953	0.669	sensory perception of light stimulus
GO:0007601	0.589	visual perception
GO:0006793	0.471	phosphorus metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005929	0.997	cilium
GO:0043005	0.995	neuron projection
GO:0097730	0.992	non-motile cilium
GO:0001750	0.975	photoreceptor outer segment
GO:0031090	0.971	organelle membrane
GO:0005622	0.859	intracellular anatomical structure
GO:0005737	0.675	cytoplasm
GO:0098588	0.609	bounding membrane of organelle
GO:0043229	0.403	intracellular organelle
GO:0098590	0.387	plasma membrane region
GO:0043231	0.385	intracellular membrane-bounded organelle
GO:0005634	0.305	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13665	1.000	GTP = 3',5'-cyclic GMP + diphosphate
EC:4.6.1.2	1.000	guanylate cyclase.

[back to server]