StarFunc result for job id Q02880

User Input

>input (1626 residues)
MAKSGGCGAGAGVGGGNGALTWVTLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQ
LEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRD
KNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVT
GGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITF
QPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKL
DETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIE
VVKKKNKAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFF
KAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLIL
TEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYK
KSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVK
ASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFR
YAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFI
NKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHH
GEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFP
AVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRM
LDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQV
LEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNS
MVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKI
QGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDETQNQHDDSSSDSGTPSG
PDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVE
SQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKK
KKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTS
SGKPSAKKVKKRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDD
DADDDDDDNNDLEELKVKASPITNDGEDEFVPSDGLDKDEYTFSPGKSKATPEKSLHDKK
SQDFGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPS
SDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGKGRGAKKRKASGSENEGDYNP
GRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGRARKEVKYFAESDEEEDDV
DFAMFN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6zy7B	0.479	0.659	0.000	1160	0.576	0.807	6zy7B.pdb.gz	Structural basis for allosteric regulation of Human Topoisomerase II alpha.
2	AFDB:O42131	0.794	0.794	0.000	1627	0.891	0.890	O42131.pdb.gz	TOP2B_CHICK DNA topoisomerase 2-beta OS=Gallus gallus OX=9031 GN=TOP2B PE=2 SV=1
3	AFDB:P15348	0.733	0.822	0.000	1447	0.488	0.548	P15348.pdb.gz	TOP2_DROME DNA topoisomerase 2 OS=Drosophila melanogaster OX=7227 GN=Top2 PE=1 SV=1
4	AFDB:Q02880	1.000	1.000	0.000	1626	1.000	1.000	Q02880.pdb.gz	TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3
5	AFDB:Q1LUT2	0.788	0.791	0.000	1618	0.737	0.740	Q1LUT2.pdb.gz	Q1LUT2_DANRE DNA topoisomerase 2 OS=Danio rerio OX=7955 GN=im:7138121 PE=1 SV=1
6	PDB:6rkwD	0.200	0.396	6.569E-30	781	0.083	0.173	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
7	PDB:6rkwC	0.234	0.440	1.338E-17	828	0.065	0.128	6rkwC.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
8	PDB:1zvuA	0.220	0.484	2.894E-15	685	0.049	0.115	1zvuA.pdb.gz
9	PDB:7p8vA	0.140	0.545	6.827E-9	331	0.031	0.151	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
10	PDB:1y4uB	0.097	0.251	1.526E-8	454	0.036	0.130	1y4uB.pdb.gz
11	PDB:6rksD	0.095	0.706	1.774E-8	200	0.036	0.295	6rksD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
12	PDB:7kclB	0.140	0.332	2.788E-8	614	0.035	0.093	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
13	PDB:2zbkB	0.122	0.329	4.846E-8	506	0.044	0.140	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms
14	PDB:5tthB	0.149	0.331	5.925E-8	621	0.049	0.127	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
15	AFDB:P07197	0.034	0.057	7.867E-1	916	0.075	0.133	P07197.pdb.gz	NFM_HUMAN Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3
16	AFDB:Q1HKZ5	0.037	0.055	9.147E-1	959	0.070	0.119	Q1HKZ5.pdb.gz	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
17	AFDB:Q9HCF6	0.029	0.028	1.011	1732	0.049	0.046	Q9HCF6.pdb.gz	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
18	AFDB:Q9NPG3	0.038	0.050	1.011	1134	0.076	0.109	Q9NPG3.pdb.gz	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
19	AFDB:Q4G0F8	0.035	0.047	1.237	1135	0.073	0.104	Q4G0F8.pdb.gz	UBN1_MOUSE Ubinuclein-1 OS=Mus musculus OX=10090 GN=Ubn1 PE=2 SV=1
20	AFDB:Q9JM52	0.030	0.036	1.512	1308	0.056	0.070	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IUF0	0.0	2021	1570	0.603	0.624	A0A0R4IUF0_DANRE DNA topoisomerase 2 OS=Danio rerio OX=7955 GN=fc08c07 PE=1 SV=2
2	A0A8I5Y7L4	0.0	3078	1614	0.951	0.958	A0A8I5Y7L4_RAT DNA topoisomerase 2 OS=Rattus norvegicus OX=10116 GN=Top2b PE=1 SV=1
3	O42130	0.0	2111	1553	0.670	0.701	TOP2A_CHICK DNA topoisomerase 2-alpha OS=Gallus gallus OX=9031 GN=TOP2A PE=2 SV=2
4	O42131	0.0	2878	1627	0.878	0.877	TOP2B_CHICK DNA topoisomerase 2-beta OS=Gallus gallus OX=9031 GN=TOP2B PE=2 SV=1
5	P06786	0.0	1058	1428	0.349	0.397	TOP2_YEAST DNA topoisomerase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOP2 PE=1 SV=2
6	P08096	0.0	1178	1485	0.374	0.409	TOP2_SCHPO DNA topoisomerase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=top2 PE=1 SV=2
7	P11388	0.0	2091	1531	0.668	0.709	TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3
8	P15348	0.0	1545	1447	0.487	0.547	TOP2_DROME DNA topoisomerase 2 OS=Drosophila melanogaster OX=7227 GN=Top2 PE=1 SV=1
9	P30182	0.0	1154	1473	0.387	0.428	TOP2_ARATH DNA topoisomerase 2 OS=Arabidopsis thaliana OX=3702 GN=TOP2 PE=2 SV=2
10	P41516	0.0	2075	1526	0.654	0.697	TOP2A_RAT DNA topoisomerase 2-alpha OS=Rattus norvegicus OX=10116 GN=Top2a PE=1 SV=1
11	P90520	0.0	940	1284	0.328	0.415	TOP2M_DICDI DNA topoisomerase 2, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=top2mt PE=2 SV=2
12	Q01320	0.0	2092	1528	0.650	0.692	TOP2A_MOUSE DNA topoisomerase 2-alpha OS=Mus musculus OX=10090 GN=Top2a PE=1 SV=2
13	Q02880	0.0	3361	1626	1.000	1.000	TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3
14	Q14TE9	0.0	3075	1614	0.950	0.957	Q14TE9_RAT DNA topoisomerase 2 OS=Rattus norvegicus OX=10116 GN=Top2b PE=2 SV=1
15	Q1LUT2	0.0	2251	1618	0.683	0.686	Q1LUT2_DANRE DNA topoisomerase 2 OS=Danio rerio OX=7955 GN=im:7138121 PE=1 SV=1
16	Q23670	0.0	1512	1520	0.453	0.484	TOP2_CAEEL DNA topoisomerase 2 top-2 OS=Caenorhabditis elegans OX=6239 GN=top-2 PE=1 SV=2
17	Q383C4	0.0	1011	1424	0.330	0.376	Q383C4_TRYB2 DNA topoisomerase 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3390 PE=3 SV=1
18	Q5B224	0.0	1065	1709	0.341	0.325	Q5B224_EMENI DNA topoisomerase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05406 PE=3 SV=1
19	Q64511	0.0	3211	1612	0.955	0.963	TOP2B_MOUSE DNA topoisomerase 2-beta OS=Mus musculus OX=10090 GN=Top2b PE=1 SV=2
20	P12531	8.36e-180	575	1221	0.242	0.323	TOP2_TRYBB DNA topoisomerase 2 OS=Trypanosoma brucei brucei OX=5702 GN=TOP2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00204 DNA_gyraseB	5e-24	96.2	DNA gyrase B
2	PF00521 DNA_topoisoIV	1.1e-128	441.5	DNA gyrase/topoisomerase IV, subunit A
3	PF08070 DTHCT	8.4e-25	98.8	DTHCT (NUC029) region
4	PF02518 HATPase_c	9.6e-12	56.8	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
5	PF01751 Toprim	2.4e-06	39.1	Toprim domain
6	PF16898 TOPRIM_C	3.8e-46	167.8	C-terminal associated domain of TOPRIM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396704

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000395654	0.985	Transcription activator BRG1
2	9606.ENSP00000354522	0.982	DNA topoisomerase 1
3	9606.ENSP00000348056	0.976	SUMO-conjugating enzyme UBC9
4	9606.ENSP00000216297	0.973	FACT complex subunit SPT16
5	9606.ENSP00000342434	0.972	Tyrosine-protein kinase BAZ1B
6	9606.ENSP00000254480	0.968	SWI/SNF complex subunit SMARCC1
7	9606.ENSP00000267064	0.964	SWI/SNF complex subunit SMARCC2
8	9606.ENSP00000323967	0.964	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
9	9606.ENSP00000328835	0.944	DNA topoisomerase I, mitochondrial
10	9606.ENSP00000320485	0.921	AT-rich interactive domain-containing protein 1A
11	9606.ENSP00000397552	0.920	Actin-like protein 6A
12	9606.ENSP00000349961	0.917	Structural maintenance of chromosomes protein 4
13	9606.ENSP00000378414	0.916	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
14	9606.ENSP00000419692	0.915	Retinoic acid receptor RXR-alpha
15	9606.ENSP00000301280	0.913	Chromatin assembly factor 1 subunit A
16	9606.ENSP00000376077	0.912	Small ubiquitin-related modifier 1
17	9606.ENSP00000260810	0.906	DNA topoisomerase 2-binding protein 1
18	9606.ENSP00000447173	0.902	Vitamin D3 receptor
19	9606.ENSP00000411532	0.898	DNA topoisomerase 2-alpha
20	9606.ENSP00000363822	0.865	Androgen receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003918	0.999	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0003682	0.983	chromatin binding
GO:0019899	0.957	enzyme binding
GO:1901363	0.922	heterocyclic compound binding
GO:0097159	0.922	organic cyclic compound binding
GO:0019900	0.882	kinase binding
GO:0003676	0.879	nucleic acid binding
GO:0019901	0.873	protein kinase binding
GO:0046983	0.850	protein dimerization activity
GO:0042826	0.849	histone deacetylase binding
GO:0005080	0.849	protein kinase C binding
GO:0046982	0.839	protein heterodimerization activity
GO:0003677	0.743	DNA binding
GO:0044877	0.554	protein-containing complex binding
GO:0003723	0.416	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0008152	0.957	metabolic process
GO:0044237	0.895	cellular metabolic process
GO:0050789	0.846	regulation of biological process
GO:0071840	0.845	cellular component organization or biogenesis
GO:0071704	0.822	organic substance metabolic process
GO:0016043	0.821	cellular component organization
GO:0044238	0.818	primary metabolic process
GO:0006807	0.805	nitrogen compound metabolic process
GO:0043170	0.787	macromolecule metabolic process
GO:0050794	0.727	regulation of cellular process
GO:1901360	0.722	organic cyclic compound metabolic process
GO:0046483	0.722	heterocycle metabolic process
GO:0006725	0.722	cellular aromatic compound metabolic process
GO:0090304	0.707	nucleic acid metabolic process
GO:0019222	0.681	regulation of metabolic process
GO:0044260	0.674	cellular macromolecule metabolic process
GO:0060255	0.637	regulation of macromolecule metabolic process
GO:0006996	0.577	organelle organization
GO:0006259	0.567	DNA metabolic process
GO:0048518	0.477	positive regulation of biological process
GO:0080090	0.430	regulation of primary metabolic process
GO:0051171	0.426	regulation of nitrogen compound metabolic process
GO:0031323	0.425	regulation of cellular metabolic process
GO:0019219	0.415	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.394	positive regulation of cellular process
GO:0009893	0.345	positive regulation of metabolic process
GO:0050896	0.317	response to stimulus
GO:0010604	0.312	positive regulation of macromolecule metabolic process
GO:0051276	0.305	chromosome organization
GO:0051716	0.302	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0031981	0.994	nuclear lumen
GO:0005654	0.964	nucleoplasm
GO:0032991	0.956	protein-containing complex
GO:0005730	0.682	nucleolus
GO:0005694	0.652	chromosome
GO:0005737	0.471	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.2	0.999	DNA topoisomerase (ATP-hydrolyzing).

[back to server]