StarFunc result for job id Q02930

User Input

>input (508 residues)
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSA
RLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSSVSEVVGSSTLSQLTTHRTDLNPIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02930	1.000	1.000	3.913E-73	508	1.000	1.000	Q02930.pdb.gz	CREB5_HUMAN Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens OX=9606 GN=CREB5 PE=1 SV=3
2	AFDB:Q4H3W1	0.175	0.144	3.803E-15	631	0.303	0.244	Q4H3W1.pdb.gz	Q4H3W1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF2/7 PE=1 SV=1
3	AFDB:P18850	0.144	0.112	1.193E-2	670	0.146	0.110	P18850.pdb.gz	ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3
4	AFDB:F6VAN0	0.150	0.120	6.251E-2	656	0.148	0.114	F6VAN0.pdb.gz	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2
5	AFDB:Q3LS93	0.067	0.097	8.826E-2	329	0.124	0.191	Q3LS93.pdb.gz	Q3LS93_STRPU Sp185/333 OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1
6	AFDB:D3Z8E6	0.150	0.055	1.335E-1	1604	0.165	0.052	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
7	AFDB:Q8MRW5	0.071	0.058	1.431E-1	640	0.134	0.106	Q8MRW5.pdb.gz	ET96B_DROME ETV5-related protein Ets96B OS=Drosophila melanogaster OX=7227 GN=Ets96B PE=2 SV=1
8	AFDB:Q9HCS4	0.071	0.064	1.431E-1	588	0.163	0.141	Q9HCS4.pdb.gz	TF7L1_HUMAN Transcription factor 7-like 1 OS=Homo sapiens OX=9606 GN=TCF7L1 PE=1 SV=1
9	AFDB:Q385M7	0.109	0.089	1.533E-1	650	0.124	0.097	Q385M7.pdb.gz	Q385M7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3080 PE=4 SV=1
10	AFDB:Q60793	0.069	0.071	1.642E-1	483	0.108	0.114	Q60793.pdb.gz	KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus OX=10090 GN=Klf4 PE=1 SV=3
11	PDB:7vciU	0.067	0.046	2.691	820	0.028	0.017	7vciU.pdb.gz
12	PDB:4h63H	0.046	0.107	4.362	174	0.031	0.092	4h63H.pdb.gz
13	PDB:4mtdD	0.028	0.071	5.748	151	0.018	0.060	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
14	PDB:4v88Ah	0.044	0.132	6.159	159	0.031	0.101	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
15	PDB:7cpuLb	0.040	0.143	6.159	99	0.030	0.152	7cpuLb.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
16	PDB:7nacm	0.064	0.053	7.575	666	0.039	0.030	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
17	PDB:7ajuCK	0.074	0.149	8.696	222	0.041	0.095	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:7tzfE	0.048	0.143	9.317	114	0.016	0.070	7tzfE.pdb.gz	A structural basis for amylin receptor phenotype.
19	PDB:6t9iE	0.044	0.050	9.983	433	0.022	0.025	6t9iE.pdb.gz
20	PDB:7ls2V2	0.060	0.168	9.983	117	0.024	0.103	7ls2V2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02930	0.0	1029	508	1.000	1.000	CREB5_HUMAN Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens OX=9606 GN=CREB5 PE=1 SV=3
2	Q8K1L0	0.0	701	357	0.689	0.980	CREB5_MOUSE Cyclic AMP-responsive element-binding protein 5 OS=Mus musculus OX=10090 GN=Creb5 PE=2 SV=3
3	P15336	9.96e-114	347	505	0.433	0.436	ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4
4	P16951	3.85e-113	345	487	0.431	0.450	ATF2_MOUSE Cyclic AMP-dependent transcription factor ATF-2 OS=Mus musculus OX=10090 GN=Atf2 PE=1 SV=2
5	Q00969	6.03e-112	342	487	0.431	0.450	ATF2_RAT Cyclic AMP-dependent transcription factor ATF-2 OS=Rattus norvegicus OX=10116 GN=Atf2 PE=1 SV=2
6	P17544	3.12e-106	327	483	0.441	0.464	ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=3
7	Q8R0S1	1.82e-102	315	413	0.419	0.516	ATF7_MOUSE Cyclic AMP-dependent transcription factor ATF-7 OS=Mus musculus OX=10090 GN=Atf7 PE=1 SV=1
8	B8ZZU6	1.17e-51	182	389	0.256	0.334	B8ZZU6_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=1
9	A7S1A3	2.89e-34	130	222	0.116	0.266	A7S1A3_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g34679 PE=1 SV=1
10	Q4H3W1	2.20e-30	127	631	0.110	0.089	Q4H3W1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF2/7 PE=1 SV=1
11	C8VJ72	5.07e-18	89.0	485	0.075	0.078	C8VJ72_EMENI AtfA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02911 PE=4 SV=1
12	P52890	5.86e-18	89.4	566	0.073	0.065	ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf1 PE=1 SV=1
13	P78962	5.14e-16	81.6	355	0.079	0.113	ATF21_SCHPO Transcription factor atf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf21 PE=3 SV=1
14	A0A0F0IP79	7.04e-10	62.8	318	0.059	0.094	ATFB_ASPPU Basic leucine zipper (bZIP) transcription factor atfB OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=atfB PE=1 SV=1
15	Q2U616	7.99e-10	62.4	318	0.059	0.094	ATFB_ASPOR Basic leucine zipper (bZIP) transcription factor atfB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=atfB PE=2 SV=1
16	Q09926	1.48e-08	56.6	171	0.063	0.187	PCR1_SCHPO Transcription factor pcr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcr1 PE=1 SV=1
17	A8MS70	1.84e-07	52.4	134	0.059	0.224	A8MS70_ARATH HY5-homolog OS=Arabidopsis thaliana OX=3702 GN=HYH PE=1 SV=1
18	Q8W191	2.54e-07	52.4	149	0.059	0.201	HYH_ARATH Transcription factor HY5-like OS=Arabidopsis thaliana OX=3702 GN=HYH PE=1 SV=1
19	Q09771	4.30e-07	52.8	209	0.041	0.100	ATF31_SCHPO Transcription factor atf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf31 PE=3 SV=1
20	P17535	4.66e-07	54.3	347	0.059	0.086	JUND_HUMAN Transcription factor JunD OS=Homo sapiens OX=9606 GN=JUND PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	2.7e-09	48.3	bZIP transcription factor
2	PF07716 bZIP_2	2.4e-06	38.8	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.2	23.5	bZIP Maf transcription factor
4	PF19776 DUF6262	4.2e+02	12.6	Family of unknown function (DUF6262)
5	PF17250 NDUFB11	4.5e+02	12.9	NADH-ubiquinone oxidoreductase 11 kDa subunit
6	PF16331 TolA_bind_tri	24	16.4	TolA binding protein trimerisation
7	PF06005 ZapB	13	17.6	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350359

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264110	0.974	Cyclic AMP-dependent transcription factor ATF-2
2	9606.ENSP00000360266	0.931	Transcription factor AP-1
3	9606.ENSP00000252818	0.911	Transcription factor jun-D
4	9606.ENSP00000306245	0.901	Proto-oncogene c-Fos
5	9606.ENSP00000357596	0.889	Cyclic AMP-responsive element-binding protein 3-like protein 4
6	9606.ENSP00000387699	0.886	Cyclic AMP-responsive element-binding protein 1
7	9606.ENSP00000399465	0.883	Cyclic AMP-dependent transcription factor ATF-7
8	9606.ENSP00000342136	0.866	Cyclic AMP-responsive element-binding protein 3
9	9606.ENSP00000329140	0.858	Cyclic AMP-responsive element-binding protein 3-like protein 2
10	9606.ENSP00000078445	0.843	Cyclic AMP-responsive element-binding protein 3-like protein 3
11	9606.ENSP00000336790	0.841	Cyclic AMP-dependent transcription factor ATF-4
12	9606.ENSP00000262367	0.840	CREB-binding protein
13	9606.ENSP00000263253	0.833	Histone acetyltransferase p300
14	9606.ENSP00000481956	0.825	Cyclic AMP-responsive element-binding protein 3-like protein 1
15	9606.ENSP00000262053	0.822	Cyclic AMP-dependent transcription factor ATF-1
16	9606.ENSP00000324806	0.818	Glycogen synthase kinase-3 beta
17	9606.ENSP00000364349	0.807	Cyclic AMP-dependent transcription factor ATF-6 beta
18	9606.ENSP00000264716	0.805	Fos-related antigen 2
19	9606.ENSP00000252996	0.804	Transcription initiation factor TFIID subunit 4
20	9606.ENSP00000269142	0.802	Transcription initiation factor TFIID subunit 4B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0042802	0.998	identical protein binding
GO:0001067	0.896	transcription regulatory region nucleic acid binding
GO:0000976	0.894	transcription cis-regulatory region binding
GO:0000981	0.873	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0140297	0.461	DNA-binding transcription factor binding
GO:0001216	0.436	DNA-binding transcription activator activity
GO:0001228	0.416	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.382	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0010604	0.992	positive regulation of macromolecule metabolic process
GO:0051173	0.991	positive regulation of nitrogen compound metabolic process
GO:0031325	0.991	positive regulation of cellular metabolic process
GO:0031328	0.975	positive regulation of cellular biosynthetic process
GO:0045893	0.961	positive regulation of DNA-templated transcription
GO:0009987	0.858	cellular process
GO:0006357	0.714	regulation of transcription by RNA polymerase II
GO:0045944	0.660	positive regulation of transcription by RNA polymerase II
GO:0050896	0.474	response to stimulus
GO:0051716	0.393	cellular response to stimulus
GO:0023052	0.390	signaling
GO:0007154	0.390	cell communication
GO:0007165	0.380	signal transduction
GO:0071704	0.313	organic substance metabolic process
GO:0048523	0.300	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.967	nucleoplasm
GO:0005576	0.961	extracellular region
GO:0031982	0.898	vesicle
GO:0005737	0.803	cytoplasm
GO:0065010	0.700	extracellular membrane-bounded organelle
GO:1903561	0.672	extracellular vesicle
GO:0070062	0.657	extracellular exosome
GO:0005829	0.534	cytosol
GO:0032991	0.434	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]