StarFunc result for job id Q02952

User Input

>input (1782 residues)
MGAGSSTEQRSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPATKLLQKNG
QLSTINGVAEQDELSLQEGDLNGQKGALNGQGALNSQEEEEVIVTEVGQRDSEDVSKRDS
DKEMATKSAVVHDITDDGQEETPEIIEQIPSSESNLEELTQPTESQANDIGFKKVFKFVG
FKFTVKKDKTEKPDTVQLLTVKKDEGEGAAGAGDHKDPSLGAGEAASKESEPKQSTEKPE
ETLKREQSHAEISPPAESGQAVEECKEEGEEKQEKEPSKSAESPTSPVTSETGSTFKKFF
TQGWAGWRKKTSFRKPKEDEVEASEKKKEQEPEKVDTEEDGKAEVASEKLTASEQAHPQE
PAESAHEPRLSAEYEKVELPSEEQVSGSQGPSEEKPAPLATEVFDEKIEVHQEEVVAEVH
VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGA
DLSPDEKVLSKPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGG
DEESGEHTQVPADSPDSQEEQKGESSASSPEEPEEITCLEKGLAEVQQDGEAEEGATSDG
EKKREGVTPWASFKKMVTPKKRVRRPSESDKEDELDKVKSATLSSTESTASEMQEEMKGS
VEEPKPEEPKRKVDTSVSWEALICVGSSKKRARRGSSSDEEGGPKAMGGDHQKADEAGKD
KETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFKRLVTPRKKSKSKLEEKS
EDSIAGSGVEHSTPDTEPGKEESWVSIKKFIPGRRKKRPDGKQEQAPVEDAGPTGANEDD
SDVPAVVPLSEYDAVEREKMEAQQAQKSAEQPEQKAATEVSKELSESQVHMMAAAVADGT
RAATIIEERSPSWISASVTEPLEQVEAEAALLTEEVLEREVIAEEEPPTVTEPLPENREA
RGDTVVSEAELTPEAVTAAETAGPLGAEEGTEASAAEETTEMVSAVSQLTDSPDTTEEAT
PVQEVEGGVPDIEEQERRTQEVLQAVAEKVKEESQLPGTGGPEDVLQPVQRAEAERPEEQ
AEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQ
AETLAGVKSQEMVMEQAIPPDSVETPTDSETDGSTPVADFDAPGTTQKDEIVEIHEENEV
ASGTQSGGTEAEAVPAQKERPPAPSSFVFQEETKEQSKMEDTLEHTDKEVSVETVSILSK
TEGTQEADQYADEKTKDVPFFEGLEGSIDTGITVSREKVTEVALKGEGTEEAECKKDDAL
ELQSHAKSPPSPVEREMVVQVEREKTEAEPTHVNEEKLEHETAVTVSEEVSKQLLQTVNV
PIIDGAKEVSSLEGSPPPCLGQEEAVCTKIQVQSSEASFTLTAAAEEEKVLGETANILET
GETLEPAGAHLVLEEKSSEKNEDFAAHPGEDAVPTGPDCQAKSTPVIVSATTKKGLSSDL
EGEKTTSLKWKSDEVDEQVACQEVKVSVAIEDLEPENGILELETKSSKLVQNIIQTAVDQ
FVRTEETATEMLTSELQTQAHVIKADSQDAGQETEKEGEEPQASAQDETPITSAKEESES
TAVGQAHSDISKDMSEASEKTMTVEVEGSTVNDQQLEEVVLPSEEEGGGAGTKSVPEDDG
HALLAERIEKSLVEPKEDEKGDDVDDPENQNSALADTDASGGLTKESPDTNGPKQKEKED
AQEVELQEGKVHSESDKAITPQAQEELQKQERESAKSELTES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02952	1.000	1.000	0.000	1782	1.000	1.000	Q02952.pdb.gz	AKA12_HUMAN A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4
2	AFDB:Q5QD51	0.072	0.075	2.079E-90	1687	0.556	0.587	Q5QD51.pdb.gz	AKA12_RAT A-kinase anchor protein 12 OS=Rattus norvegicus OX=10116 GN=Akap12 PE=1 SV=1
3	AFDB:Q9WTQ5	0.055	0.057	7.386E-88	1684	0.549	0.581	Q9WTQ5.pdb.gz	AKA12_MOUSE A-kinase anchor protein 12 OS=Mus musculus OX=10090 GN=Akap12 PE=1 SV=1
4	AFDB:A0A0R4IC31	0.053	0.057	8.978E-22	1596	0.287	0.321	A0A0R4IC31.pdb.gz	A0A0R4IC31_DANRE A kinase (PRKA) anchor protein 12b OS=Danio rerio OX=7955 GN=akap12 PE=1 SV=1
5	AFDB:Q24523	0.038	0.045	1.087E-3	1331	0.105	0.140	Q24523.pdb.gz	BUN2_DROME Protein bunched, class 2/F/G isoform OS=Drosophila melanogaster OX=7227 GN=bun PE=2 SV=4
6	AFDB:Q9VIQ9	0.029	0.026	3.565E-3	2197	0.116	0.094	Q9VIQ9.pdb.gz	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
7	AFDB:Q5TZ18	0.034	0.029	7.870E-3	2269	0.140	0.110	Q5TZ18.pdb.gz	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
8	AFDB:Q05860	0.039	0.045	9.592E-3	1466	0.084	0.102	Q05860.pdb.gz	FMN1_MOUSE Formin-1 OS=Mus musculus OX=10090 GN=Fmn1 PE=1 SV=2
9	AFDB:Q9GRZ3	0.032	0.035	2.757E-2	1641	0.093	0.101	Q9GRZ3.pdb.gz	DPY21_CAEEL Lysine-specific demethylase 9 OS=Caenorhabditis elegans OX=6239 GN=dpy-21 PE=1 SV=1
10	AFDB:D3Z1D3	0.029	0.034	5.334E-2	1412	0.104	0.132	D3Z1D3.pdb.gz	CEFIP_MOUSE Cardiac-enriched FHL2-interacting protein OS=Mus musculus OX=10090 GN=CEFIP PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02952	0.0	3477	1782	1.000	1.000	AKA12_HUMAN A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4
2	Q5QD51	0.0	1448	1687	0.570	0.602	AKA12_RAT A-kinase anchor protein 12 OS=Rattus norvegicus OX=10116 GN=Akap12 PE=1 SV=1
3	Q9WTQ5	0.0	1505	1684	0.567	0.600	AKA12_MOUSE A-kinase anchor protein 12 OS=Mus musculus OX=10090 GN=Akap12 PE=1 SV=1
4	A0A0R4IC31	3.25e-78	290	1596	0.151	0.169	A0A0R4IC31_DANRE A kinase (PRKA) anchor protein 12b OS=Danio rerio OX=7955 GN=akap12 PE=1 SV=1
5	F2Z4T4	3.50e-78	289	1533	0.151	0.175	F2Z4T4_DANRE A kinase (PRKA) anchor protein 12b OS=Danio rerio OX=7955 GN=akap12 PE=1 SV=1
6	O88799	0.38	38.1	5376	0.049	0.016	ZAN_MOUSE Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10522 RII_binding_1	0.56	21.5	RII binding domain
2	PF03832 WSK	4.4e-24	95.2	WSK motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384537

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305372	0.989	Beta-2 adrenergic receptor
2	9606.ENSP00000345502	0.887	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
3	9606.ENSP00000300093	0.886	Serine/threonine-protein kinase PLK1
4	9606.ENSP00000349541	0.855	Caveolae-associated protein 1
5	9606.ENSP00000378207	0.851	A-kinase anchor protein 5
6	9606.ENSP00000478212	0.833	A-kinase anchor protein 1, mitochondrial
7	9606.ENSP00000408695	0.832	Protein kinase C alpha type
8	9606.ENSP00000275493	0.776	Epidermal growth factor receptor
9	9606.ENSP00000441434	0.763	Nicotinamide N-methyltransferase
10	9606.ENSP00000354718	0.759	A-kinase anchor protein 13
11	9606.ENSP00000386665	0.715	Four and a half LIM domains protein 2
12	9606.ENSP00000362680	0.711	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000260191	0.651	5-hydroxytryptamine receptor 3B
14	9606.ENSP00000358777	0.651	V-type proton ATPase subunit S1
15	9606.ENSP00000405252	0.648	A-kinase anchor protein 7 isoform gamma
16	9606.ENSP00000428340	0.641	Angiopoietin-1
17	9606.ENSP00000280979	0.634	A-kinase anchor protein 6
18	9606.ENSP00000375978	0.627	X-ray repair cross-complementing protein 5
19	9606.ENSP00000264926	0.612	E3 ubiquitin-protein ligase RAD18
20	9606.ENSP00000382097	0.609	Doublecortin domain containing 2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051018	0.999	protein kinase A binding
GO:0008179	0.999	adenylate cyclase binding
GO:0035591	0.733	signaling adaptor activity
GO:0030159	0.717	signaling receptor complex adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0050794	1.000	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0023052	0.986	signaling
GO:0051716	0.981	cellular response to stimulus
GO:0007154	0.980	cell communication
GO:0007165	0.962	signal transduction
GO:0048583	0.947	regulation of response to stimulus
GO:0009966	0.941	regulation of signal transduction
GO:1902531	0.759	regulation of intracellular signal transduction
GO:0007186	0.414	G protein-coupled receptor signaling pathway
GO:0048518	0.369	positive regulation of biological process
GO:0048522	0.301	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.995	cell junction
GO:0005829	0.995	cytosol
GO:0005886	0.993	plasma membrane
GO:0043226	0.945	organelle
GO:0043231	0.843	intracellular membrane-bounded organelle
GO:0070161	0.704	anchoring junction
GO:0030055	0.666	cell-substrate junction
GO:0005925	0.627	focal adhesion
GO:0005634	0.450	nucleus
GO:0070013	0.435	intracellular organelle lumen
GO:0031981	0.433	nuclear lumen
GO:0005654	0.394	nucleoplasm
GO:0012505	0.341	endomembrane system
GO:0045202	0.310	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]