StarFunc result for job id Q03001

User Input

>input (1400 residues)
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLY
EDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITD
GNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDE
KSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLES
GVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNEC
SSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKI
SEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYR
AAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSI
HKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQ
NVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFL
EDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAAS
SSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEA
VIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQ
PENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQ
KSPVKRRRMQSSADLIIQEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q503P9	0.182	0.314	3.418E-62	786	0.304	0.541	Q503P9.pdb.gz
2	AFDB:O15020	0.170	0.101	8.543E-42	2390	0.221	0.130	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
3	AFDB:P11277	0.167	0.110	3.705E-40	2137	0.224	0.146	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
4	AFDB:Q01082	0.167	0.100	6.894E-40	2364	0.228	0.135	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
5	AFDB:Q00963	0.169	0.104	1.227E-39	2291	0.225	0.137	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
6	AFDB:F1QQE5	0.170	0.103	4.642E-39	2357	0.220	0.131	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
7	AFDB:E0AHA7	0.166	0.101	2.513E-37	2326	0.199	0.120	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
8	AFDB:Q9H254	0.165	0.104	5.859E-36	2564	0.202	0.110	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
9	AFDB:Q13696	0.218	0.766	1.870E-33	385	0.168	0.610	Q13696.pdb.gz	Q13696_HUMAN ACF7 protein (Fragment) OS=Homo sapiens OX=9606 GN=ACF7 PE=4 SV=1
10	AFDB:O60437	0.241	0.193	3.988E-32	1756	0.145	0.116	O60437.pdb.gz	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4
11	PDB:4d1eA	0.167	0.250	6.408E-20	859	0.127	0.207	4d1eA.pdb.gz
12	PDB:1sjjA	0.161	0.240	4.347E-17	863	0.135	0.219	1sjjA.pdb.gz
13	PDB:7sx8D	0.131	0.359	3.174E-6	448	0.039	0.121	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:7z8fe	0.077	0.043	1.650E-3	4579	0.126	0.038	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
15	PDB:7nfeA	0.049	0.030	2.571E-3	3585	0.116	0.045	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
16	PDB:7sglA	0.070	0.038	2.936E-3	3852	0.119	0.043	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
17	PDB:7t3uC	0.052	0.049	2.936E-3	1575	0.126	0.112	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:7k1kA	0.049	0.028	5.464E-3	3604	0.109	0.042	7k1kA.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
19	PDB:7qcdB	0.041	0.054	5.970E-3	998	0.071	0.099	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
20	PDB:7mq8LM	0.052	0.043	1.063E-2	2005	0.096	0.067	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IJ71	0.0	600	4506	0.200	0.062	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2
2	A0A286YBE9	0.0	1267	4773	0.465	0.136	A0A286YBE9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
3	A0A2R8PVX9	0.0	1267	4580	0.464	0.142	A0A2R8PVX9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
4	A0A2R8RIJ1	0.0	1265	4599	0.463	0.141	A0A2R8RIJ1_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
5	A5WV02	0.0	1273	4577	0.463	0.142	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
6	D3ZHV2	0.0	1545	5430	0.545	0.141	MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1
7	E7F8G7	0.0	1273	4762	0.464	0.136	E7F8G7_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
8	E9QCV2	0.0	773	4530	0.260	0.080	E9QCV2_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=1
9	F8W9J4	0.0	2920	7461	1.000	0.188	F8W9J4_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=1
10	H0YDN1	0.0	746	3447	0.249	0.101	H0YDN1_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=9
11	P30427	0.0	757	4687	0.254	0.076	PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2
12	Q03001	0.0	2920	7570	1.000	0.185	DYST_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4
13	Q15149	0.0	747	4684	0.249	0.074	PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3
14	Q91ZU6	0.0	2734	7393	0.941	0.178	DYST_MOUSE Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2
15	Q9JI55	0.0	748	4473	0.252	0.079	PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus OX=10029 GN=PLEC PE=1 SV=1
16	Q9QXS1	0.0	754	4691	0.253	0.075	PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3
17	Q9QXZ0	0.0	1562	7354	0.547	0.104	MACF1_MOUSE Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4 OS=Mus musculus OX=10090 GN=Macf1 PE=1 SV=2
18	Q9UPN3	0.0	1576	7388	0.552	0.105	MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4
19	Q13696	1.37e-168	511	385	0.172	0.626	Q13696_HUMAN ACF7 protein (Fragment) OS=Homo sapiens OX=9606 GN=ACF7 PE=4 SV=1
20	P15924	1.99e-149	506	2871	0.199	0.097	DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03483 B3_4	1.1e+02	13.9	B3/4 domain
2	PF11971 CAMSAP_CH	9.6e-05	33.4	CAMSAP CH domain
3	PF00307 CH	1.3e-42	155.8	Calponin homology (CH) domain
4	PF17902 SH3_10	7.8e-16	69.2	SH3 domain
5	PF00435 Spectrin	2.3e-07	42.6	Spectrin repeat
6	PF18373 Spectrin_like	3.2e-27	105.8	Spectrin like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9646.ENSAMEP00000007113

Rank	PPI partner	STRING score	Description
1	9646.ENSAMEP00000010220	0.873	Integrin, beta 4
2	9646.ENSAMEP00000019018	0.846	Collagen, type XVII, alpha 1
3	9646.ENSAMEP00000004288	0.832	Spectrin, alpha, erythrocytic 1
4	9646.ENSAMEP00000016527	0.832	Spectrin, alpha, non-erythrocytic 1
5	9646.ENSAMEP00000004784	0.776	Uncharacterized protein
6	9646.ENSAMEP00000013952	0.776	Uncharacterized protein
7	9646.ENSAMEP00000014388	0.776	Uncharacterized protein
8	9646.ENSAMEP00000006666	0.747	Plectin
9	9646.ENSAMEP00000017802	0.703	VPS18, CORVET/HOPS core subunit
10	9646.ENSAMEP00000008539	0.687	Desmoglein 1
11	9646.ENSAMEP00000008580	0.670	Desmoglein 3
12	9646.ENSAMEP00000012832	0.668	DNA polymerase eta
13	9646.ENSAMEP00000007433	0.659	Cytoskeleton associated protein 5
14	9646.ENSAMEP00000006002	0.648	Junction plakoglobin
15	9646.ENSAMEP00000001007	0.625	Renin
16	9646.ENSAMEP00000006965	0.616	Caspase 2, apoptosis-related cysteine peptidase
17	9646.ENSAMEP00000002773	0.615	SCO-spondin
18	9646.ENSAMEP00000003104	0.615	Lipase maturation factor
19	9646.ENSAMEP00000010914	0.614	Plakophilin 3
20	9646.ENSAMEP00000016562	0.605	Usherin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	1.000	cytoskeletal protein binding
GO:0042803	0.991	protein homodimerization activity
GO:0003779	0.846	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.799	cellular process
GO:0071840	0.569	cellular component organization or biogenesis
GO:0032502	0.414	developmental process
GO:0048856	0.404	anatomical structure development
GO:0016043	0.399	cellular component organization
GO:0032501	0.338	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0043226	0.995	organelle
GO:0043229	0.994	intracellular organelle
GO:0043228	0.987	non-membrane-bounded organelle
GO:0005737	0.973	cytoplasm
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0043231	0.919	intracellular membrane-bounded organelle
GO:0071944	0.905	cell periphery
GO:0005856	0.874	cytoskeleton
GO:0016020	0.851	membrane
GO:0005634	0.799	nucleus
GO:0005829	0.741	cytosol
GO:0031981	0.734	nuclear lumen
GO:0005886	0.695	plasma membrane
GO:0015630	0.653	microtubule cytoskeleton
GO:0005654	0.638	nucleoplasm
GO:0070161	0.618	anchoring junction
GO:0099080	0.414	supramolecular complex
GO:0012505	0.402	endomembrane system
GO:0099081	0.372	supramolecular polymer
GO:0099512	0.349	supramolecular fiber
GO:0043292	0.324	contractile fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]