StarFunc result for job id Q03014

User Input

>input (270 residues)
MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTS
LVSPYRTPVYEPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPL
GKPLLWSPFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ
VKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSP
ASQEDLESEISEDSDQEVDIEGDKSYFNAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43120	0.487	0.485	1.607E-35	271	0.930	0.926	P43120.pdb.gz	HHEX_MOUSE Hematopoietically-expressed homeobox protein Hhex OS=Mus musculus OX=10090 GN=Hhex PE=1 SV=1
2	AFDB:Q05502	0.418	0.409	1.280E-27	277	0.778	0.758	Q05502.pdb.gz	HHEX_CHICK Hematopoietically-expressed homeobox protein HHEX OS=Gallus gallus OX=9031 GN=HHEX PE=1 SV=1
3	AFDB:O13023	0.457	0.455	1.808E-25	272	0.715	0.710	O13023.pdb.gz	HHEX_XENLA Hematopoietically-expressed homeobox protein hhex OS=Xenopus laevis OX=8355 GN=hhex PE=2 SV=1
4	AFDB:Q6R3Q6	0.275	0.314	6.514E-9	227	0.252	0.300	Q6R3Q6.pdb.gz	BSH_DANRE Brain-specific homeobox protein homolog OS=Danio rerio OX=7955 GN=bsx PE=2 SV=1
5	AFDB:Q6SYZ1	0.253	0.223	2.356E-8	311	0.252	0.219	Q6SYZ1.pdb.gz	Q6SYZ1_DANRE Homeodomain protein Hb9 OS=Danio rerio OX=7955 GN=hb9 PE=2 SV=1
6	AFDB:Q3C1V8	0.272	0.307	3.250E-8	233	0.274	0.318	Q3C1V8.pdb.gz	BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens OX=9606 GN=BSX PE=2 SV=2
7	AFDB:B8JMG3	0.268	0.209	5.097E-8	356	0.293	0.222	B8JMG3.pdb.gz
8	AFDB:Q14774	0.274	0.161	7.496E-8	488	0.304	0.168	Q14774.pdb.gz	HLX_HUMAN H2.0-like homeobox protein OS=Homo sapiens OX=9606 GN=HLX PE=1 SV=3
9	AFDB:P13297	0.276	0.249	1.426E-7	303	0.241	0.215	P13297.pdb.gz	MSX1_MOUSE Homeobox protein MSX-1 OS=Mus musculus OX=10090 GN=Msx1 PE=1 SV=4
10	AFDB:Q9QZW9	0.247	0.171	1.621E-7	404	0.274	0.183	Q9QZW9.pdb.gz	MNX1_MOUSE Motor neuron and pancreas homeobox protein 1 OS=Mus musculus OX=10090 GN=Mnx1 PE=1 SV=2
11	PDB:4egcA	0.173	0.087	1.228E-2	539	0.059	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.194	0.628	2.831E-2	73	0.085	0.315	2hi3A.pdb.gz
13	PDB:5nr5A	0.168	0.353	5.449E-1	113	0.070	0.168	5nr5A.pdb.gz
14	PDB:7fbyA	0.137	0.225	1.733	153	0.026	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5aj0BZ	0.153	0.416	2.391	86	0.030	0.093	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:5z56L	0.162	0.131	2.719	342	0.048	0.038	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:7w59R	0.088	0.085	3.998	280	0.059	0.057	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
18	PDB:5mrca	0.123	0.176	4.849	177	0.059	0.090	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:5x6cA	0.097	0.054	4.849	539	0.022	0.011	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
20	PDB:2y75E	0.104	0.190	5.170	129	0.037	0.078	2y75E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03014	0.0	552	270	1.000	1.000	HHEX_HUMAN Hematopoietically-expressed homeobox protein HHEX OS=Homo sapiens OX=9606 GN=HHEX PE=1 SV=1
2	Q9WV22	2.46e-162	452	271	0.926	0.923	Q9WV22_RAT Hematopoietically expressed homeobox OS=Rattus norvegicus OX=10116 GN=Hhex PE=1 SV=1
3	P43120	2.62e-160	447	271	0.911	0.908	HHEX_MOUSE Hematopoietically-expressed homeobox protein Hhex OS=Mus musculus OX=10090 GN=Hhex PE=1 SV=1
4	O13023	4.66e-137	389	272	0.733	0.728	HHEX_XENLA Hematopoietically-expressed homeobox protein hhex OS=Xenopus laevis OX=8355 GN=hhex PE=2 SV=1
5	Q05502	1.11e-127	365	277	0.722	0.704	HHEX_CHICK Hematopoietically-expressed homeobox protein HHEX OS=Gallus gallus OX=9031 GN=HHEX PE=1 SV=1
6	Q9IAV3	2.15e-93	276	228	0.552	0.654	HHEX_DANRE Hematopoietically-expressed homeobox protein hhex OS=Danio rerio OX=7955 GN=hhex PE=2 SV=1
7	Q21578	1.13e-26	105	214	0.174	0.220	HHEXH_CAEEL Homeobox protein HEX homolog pha-2 OS=Caenorhabditis elegans OX=6239 GN=pha-2 PE=2 SV=5
8	Q9VDF0	2.70e-21	93.2	323	0.148	0.124	Q9VDF0_DROME Hematopoietically expressed homeobox OS=Drosophila melanogaster OX=7227 GN=HHEX PE=4 SV=2
9	Q6NY96	3.49e-17	82.0	327	0.174	0.144	Q6NY96_DANRE H2.0-like homeo box 1 (Drosophila) OS=Danio rerio OX=7955 GN=fa28a07 PE=2 SV=1
10	Q61670	3.82e-17	82.8	476	0.141	0.080	HLX_MOUSE H2.0-like homeobox protein OS=Mus musculus OX=10090 GN=Hlx PE=2 SV=1
11	Q14774	4.83e-17	82.4	488	0.141	0.078	HLX_HUMAN H2.0-like homeobox protein OS=Homo sapiens OX=9606 GN=HLX PE=1 SV=3
12	Q810B3	5.11e-16	77.0	232	0.222	0.259	BSH_MOUSE Brain-specific homeobox protein homolog OS=Mus musculus OX=10090 GN=Bsx PE=1 SV=1
13	P52951	6.15e-16	78.6	348	0.133	0.103	GBX2_HUMAN Homeobox protein GBX-2 OS=Homo sapiens OX=9606 GN=GBX2 PE=2 SV=3
14	P48031	7.25e-16	78.6	348	0.133	0.103	GBX2_MOUSE Homeobox protein GBX-2 OS=Mus musculus OX=10090 GN=Gbx2 PE=2 SV=1
15	Q8QGU1	7.28e-16	78.2	342	0.133	0.105	Q8QGU1_DANRE Gastrulation brain homeo box 2 OS=Danio rerio OX=7955 GN=fd07f12 PE=2 SV=1
16	A0A2R8QHC0	7.29e-16	78.2	309	0.141	0.123	A0A2R8QHC0_DANRE T cell leukemia homeobox 2 OS=Danio rerio OX=7955 GN=Tlx-3a PE=4 SV=1
17	O55144	7.76e-16	77.8	291	0.141	0.131	TLX3_MOUSE T-cell leukemia homeobox protein 3 OS=Mus musculus OX=10090 GN=Tlx3 PE=2 SV=2
18	O43711	8.08e-16	77.8	291	0.141	0.131	TLX3_HUMAN T-cell leukemia homeobox protein 3 OS=Homo sapiens OX=9606 GN=TLX3 PE=1 SV=3
19	Q3C1V8	1.00e-15	76.3	233	0.222	0.258	BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens OX=9606 GN=BSX PE=2 SV=2
20	A1A5U3	1.01e-15	77.4	301	0.141	0.126	A1A5U3_DANRE T cell leukemia homeobox 2 OS=Danio rerio OX=7955 GN=tlx3a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	19	16.6	Homeobox KN domain
2	PF00046 Homeodomain	3.1e-17	73.5	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282728

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000274695	0.870	Threonylcarbamoyladenosine tRNA methylthiotransferase
2	9606.ENSP00000415011	0.849	Zinc transporter 8
3	9606.ENSP00000371634	0.826	Insulin-like growth factor 2 mRNA-binding protein 2
4	9606.ENSP00000358404	0.809	Transcription factor 7-like 2
5	9606.ENSP00000385995	0.784	Thyroid adenoma-associated protein
6	9606.ENSP00000360266	0.779	Transcription factor AP-1
7	9606.ENSP00000345708	0.747	ATP-sensitive inward rectifier potassium channel 11
8	9606.ENSP00000226760	0.741	Wolframin
9	9606.ENSP00000356172	0.741	Transcription factor SOX-13
10	9606.ENSP00000281141	0.736	Cell division cycle protein 123 homolog
11	9606.ENSP00000418823	0.731	Alpha-ketoglutarate-dependent dioxygenase FTO
12	9606.ENSP00000260731	0.730	Kinesin-like protein KIF11
13	9606.ENSP00000283928	0.708	Juxtaposed with another zinc finger protein 1
14	9606.ENSP00000257068	0.705	Melatonin receptor type 1B
15	9606.ENSP00000269216	0.690	Transcription factor GATA-6
16	9606.ENSP00000155840	0.684	Potassium voltage-gated channel subfamily KQT member 1
17	9606.ENSP00000452871	0.681	Transducin-like enhancer protein 3
18	9606.ENSP00000302630	0.679	Hepatocyte nuclear factor 6
19	9606.ENSP00000345681	0.672	Endothelial transcription factor GATA-2
20	9606.ENSP00000478874	0.664	Calcium/calmodulin-dependent protein kinase type 1D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0005515	0.995	protein binding
GO:0003700	0.993	DNA-binding transcription factor activity
GO:0000981	0.962	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.949	transcription cis-regulatory region binding
GO:0000977	0.861	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001217	0.366	DNA-binding transcription repressor activity
GO:0001227	0.337	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0019904	0.317	protein domain specific binding
GO:0071837	0.308	HMG box domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.977	positive regulation of biological process
GO:0009987	0.975	cellular process
GO:0048519	0.973	negative regulation of biological process
GO:0032502	0.970	developmental process
GO:0006357	0.961	regulation of transcription by RNA polymerase II
GO:0048856	0.918	anatomical structure development
GO:0032501	0.862	multicellular organismal process
GO:0048523	0.839	negative regulation of cellular process
GO:0048522	0.822	positive regulation of cellular process
GO:0023051	0.751	regulation of signaling
GO:0007275	0.733	multicellular organism development
GO:0010646	0.722	regulation of cell communication
GO:0048513	0.700	animal organ development
GO:0048731	0.674	system development
GO:0050896	0.641	response to stimulus
GO:0009893	0.557	positive regulation of metabolic process
GO:0030154	0.548	cell differentiation
GO:0010604	0.504	positive regulation of macromolecule metabolic process
GO:0048583	0.483	regulation of response to stimulus
GO:0009653	0.477	anatomical structure morphogenesis
GO:0009892	0.467	negative regulation of metabolic process
GO:0051173	0.422	positive regulation of nitrogen compound metabolic process
GO:0031325	0.418	positive regulation of cellular metabolic process
GO:0010605	0.408	negative regulation of macromolecule metabolic process
GO:0009891	0.398	positive regulation of biosynthetic process
GO:0051254	0.398	positive regulation of RNA metabolic process
GO:0031324	0.380	negative regulation of cellular metabolic process
GO:0009966	0.367	regulation of signal transduction
GO:0010557	0.365	positive regulation of macromolecule biosynthetic process
GO:0031328	0.365	positive regulation of cellular biosynthetic process
GO:0045893	0.363	positive regulation of DNA-templated transcription
GO:0009890	0.358	negative regulation of biosynthetic process
GO:0051172	0.350	negative regulation of nitrogen compound metabolic process
GO:0031327	0.341	negative regulation of cellular biosynthetic process
GO:0051253	0.341	negative regulation of RNA metabolic process
GO:0045892	0.318	negative regulation of DNA-templated transcription
GO:0045944	0.310	positive regulation of transcription by RNA polymerase II
GO:0051716	0.303	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.713	cytoplasm
GO:0043233	0.363	organelle lumen
GO:0070013	0.349	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]