StarFunc result for job id Q03052

User Input

>input (451 residues)
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGA
GAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQG
AAHAGAAWAQGSTAHHLGPAMSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGG
GGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSS
VGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQ
LSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLK
CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPG
GGGASPPSAPPPPPPAALHHHHHHTLPGSVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P20267	0.400	0.400	6.667E-53	451	0.991	0.991	P20267.pdb.gz	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
2	AFDB:Q2VUE0	0.362	0.614	9.319E-24	260	0.419	0.727	Q2VUE0.pdb.gz	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
3	AFDB:Q90270	0.359	0.344	1.777E-18	472	0.328	0.314	Q90270.pdb.gz	PO5F1_DANRE POU domain, class 5, transcription factor 1 OS=Danio rerio OX=7955 GN=pou5f1 PE=2 SV=1
4	AFDB:Q9DAC9	0.169	0.230	6.852E-11	329	0.213	0.292	Q9DAC9.pdb.gz	PO5F2_MOUSE POU domain, class 5, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou5f2 PE=2 SV=1
5	PDB:6t90K	0.146	0.886	2.859E-6	73	0.115	0.712	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
6	AFDB:Q6XBJ3	0.215	0.196	3.583E-5	505	0.149	0.133	Q6XBJ3.pdb.gz	ONEC2_MOUSE One cut domain family member 2 OS=Mus musculus OX=10090 GN=Onecut2 PE=2 SV=2
7	AFDB:Q9QZW9	0.145	0.159	1.325E-3	404	0.177	0.198	Q9QZW9.pdb.gz	MNX1_MOUSE Motor neuron and pancreas homeobox protein 1 OS=Mus musculus OX=10090 GN=Mnx1 PE=1 SV=2
8	AFDB:Q9NHP8	0.139	0.123	2.026E-3	513	0.204	0.179	Q9NHP8.pdb.gz	Q9NHP8_DROME GTX/Nkx6B-like homeodomain protein OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
9	AFDB:Q9SJJ3	0.103	0.089	1.168E-2	584	0.162	0.125	Q9SJJ3.pdb.gz	BLH8_ARATH BEL1-like homeodomain protein 8 OS=Arabidopsis thaliana OX=3702 GN=BLH8 PE=1 SV=1
10	AFDB:P78367	0.133	0.180	1.299E-2	333	0.186	0.252	P78367.pdb.gz	NKX32_HUMAN Homeobox protein Nkx-3.2 OS=Homo sapiens OX=9606 GN=NKX3-2 PE=1 SV=2
11	PDB:4egcA	0.112	0.100	1.398E-2	539	0.069	0.058	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	AFDB:O94988	0.082	0.043	1.987E-2	1023	0.115	0.051	O94988.pdb.gz	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
13	PDB:5iplF	0.093	0.124	3.206E-1	277	0.064	0.105	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
14	PDB:7fbyA	0.095	0.242	6.743E-1	153	0.022	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:6dv9F	0.073	0.145	7.110E-1	174	0.053	0.138	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
16	PDB:7f0rF	0.094	0.137	7.498E-1	278	0.053	0.086	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
17	PDB:2hi3A	0.110	0.545	9.778E-1	73	0.029	0.178	2hi3A.pdb.gz
18	PDB:4ye6A	0.102	0.072	1.087	709	0.038	0.024	4ye6A.pdb.gz
19	PDB:3g46A	0.063	0.154	1.209	146	0.058	0.178	3g46A.pdb.gz	Ligand migration and cavities within Scapharca Dimeric HbI: studies by time-resolved crystallo-graphy, Xe binding, and computational analysis.
20	PDB:2cg4A	0.095	0.251	1.950	149	0.016	0.047	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P20267	0.0	868	451	0.991	0.991	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
2	P21952	0.0	862	449	0.989	0.993	PO3F1_MOUSE POU domain, class 3, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou3f1 PE=1 SV=1
3	Q03052	0.0	876	451	1.000	1.000	PO3F1_HUMAN POU domain, class 3, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU3F1 PE=2 SV=3
4	O73861	7.21e-142	412	372	0.574	0.696	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
5	P79746	1.06e-113	340	378	0.461	0.550	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1
6	Q2VUE0	3.02e-110	327	260	0.348	0.604	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
7	P62515	2.37e-106	321	361	0.412	0.515	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
8	P62516	2.37e-106	321	361	0.412	0.515	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
9	A0A2R8Y739	3.50e-106	321	361	0.419	0.524	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
10	P49335	3.52e-105	318	361	0.417	0.521	PO3F4_HUMAN POU domain, class 3, transcription factor 4 OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=2
11	P20265	5.31e-105	321	443	0.348	0.354	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4
12	P56222	6.64e-105	320	445	0.346	0.351	PO3F2_RAT POU domain, class 3, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou3f2 PE=1 SV=1
13	P31360	6.27e-100	308	445	0.497	0.503	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
14	P16241	2.61e-98	303	427	0.333	0.351	CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5
15	P20268	1.28e-77	248	380	0.279	0.332	HM06_CAEEL Homeobox protein ceh-6 OS=Caenorhabditis elegans OX=6239 GN=ceh-6 PE=1 SV=3
16	A7Y7W2	3.70e-71	231	389	0.233	0.270	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
17	P31362	5.53e-66	219	431	0.282	0.295	PO2F3_MOUSE POU domain, class 2, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou2f3 PE=2 SV=3
18	Q9UKI9	5.71e-66	219	436	0.262	0.271	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
19	P42571	2.55e-64	215	430	0.255	0.267	PO2F3_RAT POU domain, class 2, transcription factor 3 OS=Rattus norvegicus OX=10116 GN=Pou2f3 PE=2 SV=2
20	Q29076	6.79e-64	221	745	0.224	0.136	PO2F1_PIG POU domain, class 2, transcription factor 1 OS=Sus scrofa OX=9823 GN=POU2F1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	1.4e+02	13.8	Homeobox KN domain
2	PF00046 Homeodomain	1.3e-14	65.1	Homeodomain
3	PF13560 HTH_31	1.9e+02	13.8	Helix-turn-helix domain
4	PF00157 Pou	1.6e-33	125.8	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362103

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242480	0.968	E3 SUMO-protein ligase EGR2
2	9606.ENSP00000380093	0.942	Transcription factor SOX-10
3	9606.ENSP00000356581	0.938	Adhesion G-protein coupled receptor G6
4	9606.ENSP00000395654	0.918	Transcription activator BRG1
5	9606.ENSP00000430432	0.912	Histone deacetylase 2
6	9606.ENSP00000329170	0.839	POU domain, class 3, transcription factor 2
7	9606.ENSP00000323588	0.640	Transcription factor SOX-2
8	9606.ENSP00000432943	0.618	Myelin protein P0
9	9606.ENSP00000359567	0.585	Transcription factor SOX-3
10	9606.ENSP00000361653	0.585	Forkhead box protein J3
11	9606.ENSP00000230658	0.568	Insulin gene enhancer protein ISL-1
12	9606.ENSP00000263102	0.564	Coiled-coil domain containing 6
13	9606.ENSP00000318057	0.558	Early growth response protein 3
14	9606.ENSP00000469142	0.552	Neuronal PAS domain-containing protein 1
15	9606.ENSP00000360811	0.549	LIM/homeobox protein Lhx3
16	9606.ENSP00000343819	0.545	Homeobox protein OTX2
17	9606.ENSP00000347646	0.533	Transcription factor SOX-12
18	9606.ENSP00000348460	0.531	Neuronal PAS domain-containing protein 3
19	9606.ENSP00000309336	0.525	Homeobox protein Hox-C5
20	9606.ENSP00000484803	0.525	Forkhead box protein P1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.995	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.995	transcription cis-regulatory region binding
GO:0000977	0.982	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0005515	0.973	protein binding
GO:0000978	0.965	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001217	0.859	DNA-binding transcription repressor activity
GO:0001227	0.852	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001216	0.563	DNA-binding transcription activator activity
GO:0001228	0.526	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.993	anatomical structure development
GO:0032501	0.987	multicellular organismal process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.985	cellular process
GO:0006355	0.972	regulation of DNA-templated transcription
GO:0007275	0.966	multicellular organism development
GO:0048518	0.963	positive regulation of biological process
GO:0048522	0.954	positive regulation of cellular process
GO:0010604	0.943	positive regulation of macromolecule metabolic process
GO:0048731	0.917	system development
GO:0030154	0.897	cell differentiation
GO:0007399	0.817	nervous system development
GO:0007272	0.803	ensheathment of neurons
GO:0042063	0.792	gliogenesis
GO:0051173	0.761	positive regulation of nitrogen compound metabolic process
GO:0009891	0.743	positive regulation of biosynthetic process
GO:0031325	0.742	positive regulation of cellular metabolic process
GO:0031328	0.676	positive regulation of cellular biosynthetic process
GO:0045935	0.676	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.671	positive regulation of DNA-templated transcription
GO:0006357	0.650	regulation of transcription by RNA polymerase II
GO:0010001	0.492	glial cell differentiation
GO:0045944	0.463	positive regulation of transcription by RNA polymerase II
GO:0048519	0.446	negative regulation of biological process
GO:0048523	0.443	negative regulation of cellular process
GO:0051172	0.381	negative regulation of nitrogen compound metabolic process
GO:0031324	0.378	negative regulation of cellular metabolic process
GO:0010605	0.366	negative regulation of macromolecule metabolic process
GO:0045892	0.349	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.987	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]