StarFunc result for job id Q03112

User Input

>input (1230 residues)
MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDP
SYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATS
SGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSL
NKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLT
FPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQD
ILKALSKHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDIESDKEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPL
KMEPQSPGEVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTPATSQDQPLDLSMGSR
SRASGTKLTEPRKNHVFGGKKGSNVESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPNAL
PENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVR
NIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKED
AYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLDE
EDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSALDH
IRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESL
HSTSHSSSNVWHSMARAAAESSAIQSISHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P14404	0.391	0.391	0.000	1232	0.932	0.930	P14404.pdb.gz	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
2	AFDB:A2A935	0.293	0.285	1.234E-102	1275	0.538	0.519	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
3	AFDB:Q9HAZ2	0.248	0.240	5.318E-102	1276	0.542	0.523	Q9HAZ2.pdb.gz	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
4	AFDB:M9PBR0	0.072	0.072	7.800E-18	1216	0.151	0.153	M9PBR0.pdb.gz	M9PBR0_DROME Blimp-1, isoform B OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=4 SV=1
5	AFDB:A2A7B5	0.087	0.066	2.557E-14	1709	0.198	0.143	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
6	AFDB:Q13029	0.091	0.073	1.794E-13	1718	0.209	0.150	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
7	AFDB:Q13127	0.127	0.140	3.296E-13	1097	0.154	0.172	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
8	AFDB:A0A1W2PQA1	0.105	0.118	2.312E-12	1069	0.146	0.168	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
9	AFDB:Q2EI20	0.133	0.183	4.799E-12	855	0.117	0.168	Q2EI20.pdb.gz	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
10	AFDB:Q5EXX3	0.069	0.070	6.914E-12	1203	0.163	0.166	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
11	PDB:3w5kB	0.046	0.258	8.548E-4	110	0.030	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:2g46A	0.058	0.475	8.637E-3	119	0.012	0.126	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
13	PDB:1pegA	0.057	0.247	2.745E-2	266	0.016	0.075	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
14	PDB:5h6zA	0.054	0.409	4.748E-2	123	0.017	0.171	5h6zA.pdb.gz
15	PDB:5hynA	0.063	0.130	6.437E-2	581	0.020	0.043	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
16	PDB:5v3hA	0.042	0.092	9.274E-2	438	0.030	0.084	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
17	PDB:7td5F	0.060	0.155	1.113E-1	447	0.021	0.058	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
18	PDB:7td5A	0.060	0.141	1.257E-1	497	0.021	0.052	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
19	PDB:5wg6A	0.060	0.136	1.604E-1	517	0.020	0.048	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
20	PDB:7ksoA	0.058	0.166	2.046E-1	395	0.020	0.063	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C3SFZ7	0.0	2144	1052	0.847	0.990	A0A0C3SFZ7_HUMAN MDS1 and EVI1 complex locus OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=1
2	A2A935	0.0	1138	1275	0.536	0.517	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
3	B7ZRU9	0.0	1680	1055	0.663	0.773	EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis OX=8355 GN=mecom-a PE=1 SV=1
4	D6RDW0	0.0	1100	1178	0.502	0.525	D6RDW0_HUMAN PR/SET domain 16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=1
5	D6RFY3	0.0	1105	1177	0.502	0.525	D6RFY3_HUMAN PR/SET domain 16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=1
6	E7EUL6	0.0	2068	1003	0.811	0.995	E7EUL6_HUMAN MDS1 and EVI1 complex locus OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=1
7	H0YA13	0.0	981	1084	0.468	0.531	H0YA13_HUMAN PR/SET domain 16 (Fragment) OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=1
8	P14404	0.0	2383	1232	0.932	0.930	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
9	Q03112	0.0	2561	1230	1.000	1.000	MECOM_HUMAN Histone-lysine N-methyltransferase MECOM OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=3
10	Q9HAZ2	0.0	1142	1276	0.544	0.524	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
11	Q8I7Z8	8.39e-59	223	990	0.086	0.107	HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1
12	Q9UKN5	4.42e-39	159	801	0.091	0.140	PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens OX=9606 GN=PRDM4 PE=1 SV=3
13	Q96EQ9	1.47e-37	155	843	0.094	0.138	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
14	Q14593	1.75e-37	152	569	0.076	0.165	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
15	Q6ZNH5	4.23e-37	149	498	0.066	0.163	ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens OX=9606 GN=ZNF497 PE=1 SV=2
16	Q8IYB9	6.28e-37	151	648	0.072	0.136	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
17	Q9QZP2	1.60e-36	151	798	0.093	0.143	PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus OX=10116 GN=Prdm4 PE=2 SV=1
18	P10073	6.94e-36	145	491	0.067	0.167	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
19	Q9H8G1	1.80e-35	145	570	0.073	0.158	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
20	Q2NKJ9	1.93e-35	145	569	0.073	0.158	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09237 GAGA	34	15.9	GAGA factor
2	PF02892 zf-BED	9	17.7	BED zinc finger
3	PF00096 zf-C2H2	2.3e-45	161.7	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	18	16.5	zinc-finger C2H2-type
5	PF13894 zf-C2H2_4	1.3e-28	108.2	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	1.2e-09	49.2	C2H2-type zinc finger
7	PF15909 zf-C2H2_8	45	15.8	C2H2-type zinc ribbon
8	PF12171 zf-C2H2_jaz	7.8e-07	40.5	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	2.2e-29	111.7	Zinc-finger double domain
10	PF13909 zf-H2C2_5	0.0022	29.0	C2H2-type zinc-finger domain
11	PF12874 zf-met	68	15.3	Zinc-finger of C2H2 type
12	PF09723 Zn-ribbon_8	26	16.4	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012769

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000010279	0.954	C-terminal binding protein 1
2	9593.ENSGGOP00000011454	0.900	Histone deacetylase 1
3	9593.ENSGGOP00000025688	0.897	C-terminal binding protein 2
4	9593.ENSGGOP00000005320	0.889	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
5	9593.ENSGGOP00000012545	0.856	Runt-related transcription factor
6	9593.ENSGGOP00000011029	0.840	RB binding protein 4, chromatin remodeling factor
7	9593.ENSGGOP00000003092	0.830	Mitogen-activated protein kinase 10
8	9593.ENSGGOP00000011486	0.830	Mitogen-activated protein kinase 8
9	9593.ENSGGOP00000023531	0.830	Mitogen-activated protein kinase 9
10	9593.ENSGGOP00000024644	0.742	Enhancer of zeste 2 polycomb repressive complex 2 subunit
11	9593.ENSGGOP00000013807	0.709	SET binding protein 1
12	9593.ENSGGOP00000004530	0.705	Euchromatic histone-lysine N-methyltransferase 1
13	9593.ENSGGOP00000020086	0.672	Belongs to the acetyltransferase family. GCN5 subfamily.
14	9593.ENSGGOP00000028611	0.659	Gamma-aminobutyric acid (GABA) A receptor, alpha 3
15	9593.ENSGGOP00000012796	0.653	Peroxisome proliferator-activated receptor gamma
16	9593.ENSGGOP00000022173	0.651	Myelodysplastic syndrome 2 translocation associated
17	9593.ENSGGOP00000003605	0.636	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
18	9593.ENSGGOP00000010105	0.627	SUZ12 polycomb repressive complex 2 subunit
19	9593.ENSGGOP00000007362	0.623	Embryonic ectoderm development
20	9593.ENSGGOP00000024387	0.610	CCAAT/enhancer binding protein (C/EBP), beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0018024	1.000	histone lysine N-methyltransferase activity
GO:0001228	0.996	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.995	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.992	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140938	0.990	histone H3 methyltransferase activity
GO:0046974	0.934	histone H3K9 methyltransferase activity
GO:0008134	0.689	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.998	regulation of DNA-templated transcription
GO:0048519	0.996	negative regulation of biological process
GO:0048523	0.987	negative regulation of cellular process
GO:0051172	0.986	negative regulation of nitrogen compound metabolic process
GO:0010605	0.982	negative regulation of macromolecule metabolic process
GO:0045934	0.978	negative regulation of nucleobase-containing compound metabolic process
GO:0048518	0.972	positive regulation of biological process
GO:1903507	0.970	negative regulation of nucleic acid-templated transcription
GO:0048522	0.957	positive regulation of cellular process
GO:0009893	0.929	positive regulation of metabolic process
GO:0009987	0.928	cellular process
GO:0045892	0.925	negative regulation of DNA-templated transcription
GO:0010604	0.920	positive regulation of macromolecule metabolic process
GO:0051173	0.915	positive regulation of nitrogen compound metabolic process
GO:0032502	0.904	developmental process
GO:0032501	0.902	multicellular organismal process
GO:0031325	0.891	positive regulation of cellular metabolic process
GO:0071840	0.884	cellular component organization or biogenesis
GO:0006357	0.859	regulation of transcription by RNA polymerase II
GO:0016043	0.858	cellular component organization
GO:0048856	0.840	anatomical structure development
GO:0007275	0.802	multicellular organism development
GO:0000122	0.755	negative regulation of transcription by RNA polymerase II
GO:0045935	0.752	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.748	positive regulation of macromolecule biosynthetic process
GO:0048583	0.743	regulation of response to stimulus
GO:0051254	0.742	positive regulation of RNA metabolic process
GO:0023051	0.740	regulation of signaling
GO:0010646	0.740	regulation of cell communication
GO:0031328	0.725	positive regulation of cellular biosynthetic process
GO:0006325	0.722	chromatin organization
GO:1902680	0.715	positive regulation of RNA biosynthetic process
GO:0009966	0.705	regulation of signal transduction
GO:0045893	0.704	positive regulation of DNA-templated transcription
GO:0045595	0.688	regulation of cell differentiation
GO:0048869	0.682	cellular developmental process
GO:0030154	0.672	cell differentiation
GO:0048731	0.657	system development
GO:0048513	0.624	animal organ development
GO:0050896	0.603	response to stimulus
GO:0045944	0.536	positive regulation of transcription by RNA polymerase II
GO:0051239	0.434	regulation of multicellular organismal process
GO:0008152	0.430	metabolic process
GO:0071704	0.407	organic substance metabolic process
GO:0051094	0.391	positive regulation of developmental process
GO:0044237	0.366	cellular metabolic process
GO:0044238	0.362	primary metabolic process
GO:0042127	0.357	regulation of cell population proliferation
GO:0006807	0.352	nitrogen compound metabolic process
GO:0010629	0.347	negative regulation of gene expression
GO:0044260	0.345	cellular macromolecule metabolic process
GO:0051716	0.336	cellular response to stimulus
GO:0006996	0.318	organelle organization
GO:0006950	0.317	response to stress
GO:0048585	0.315	negative regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	1.000	nuclear lumen
GO:0005737	0.997	cytoplasm
GO:0005654	0.988	nucleoplasm
GO:0043232	0.863	intracellular non-membrane-bounded organelle
GO:0005829	0.552	cytosol
GO:0032991	0.410	protein-containing complex
GO:0016604	0.312	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]