StarFunc result for job id Q03135

User Input

>input (178 residues)
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33724	0.778	0.778	2.350E-26	178	0.961	0.961	P33724.pdb.gz	CAV1_CANLF Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CAV1 PE=1 SV=1
2	AFDB:P35431	0.753	0.753	3.548E-23	178	0.865	0.865	P35431.pdb.gz	CAV1_CHICK Caveolin-1 OS=Gallus gallus OX=9031 GN=CAV1 PE=2 SV=1
3	AFDB:Q6YLH9	0.762	0.750	1.918E-19	181	0.742	0.729	Q6YLH9.pdb.gz	Q6YLH9_DANRE Caveolin OS=Danio rerio OX=7955 GN=CAV1 PE=1 SV=1
4	AFDB:W5UMJ4	0.579	0.574	4.294E-19	180	0.730	0.722	W5UMJ4.pdb.gz	W5UMJ4_ICTPU Caveolin OS=Ictalurus punctatus OX=7998 GN=cav1 PE=2 SV=1
5	AFDB:Q6YLH7	0.737	0.865	1.480E-16	150	0.573	0.680	Q6YLH7.pdb.gz	Q6YLH7_DANRE Caveolin OS=Danio rerio OX=7955 GN=im:6902906 PE=1 SV=1
6	PDB:7sc0A	0.535	0.691	8.615E-16	129	0.725	1.000	7sc0A.pdb.gz
7	AFDB:P51637	0.735	0.860	9.700E-16	151	0.528	0.623	P51637.pdb.gz	CAV3_MOUSE Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 SV=1
8	AFDB:P51636	0.430	0.467	2.652E-8	162	0.292	0.321	P51636.pdb.gz	CAV2_HUMAN Caveolin-2 OS=Homo sapiens OX=9606 GN=CAV2 PE=1 SV=2
9	AFDB:Q2IBC5	0.398	0.434	2.836E-8	162	0.320	0.352	Q2IBC5.pdb.gz	CAV2_RAT Caveolin-2 OS=Rattus norvegicus OX=10116 GN=Cav2 PE=1 SV=2
10	AFDB:Q94051	0.564	0.443	7.766E-8	235	0.275	0.209	Q94051.pdb.gz	CAV1_CAEEL Caveolin-1 OS=Caenorhabditis elegans OX=6239 GN=cav-1 PE=2 SV=1
11	AFDB:Q66WT7	0.423	0.460	1.016E-7	162	0.292	0.321	Q66WT7.pdb.gz	CAV2_BOVIN Caveolin-2 OS=Bos taurus OX=9913 GN=CAV2 PE=1 SV=1
12	PDB:6gwjD	0.100	0.332	2.157	48	0.034	0.125	6gwjD.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
13	PDB:5mqfL	0.243	0.141	3.227	336	0.135	0.071	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
14	PDB:4mtlB	0.107	0.093	3.691	219	0.045	0.037	4mtlB.pdb.gz	Human Methyltransferase-Like Protein 21C
15	PDB:5apnP	0.087	0.085	3.691	183	0.017	0.016	5apnP.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
16	PDB:7ajuJJ	0.093	0.084	3.691	199	0.051	0.045	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:7nvoD	0.097	0.077	3.948	247	0.062	0.045	7nvoD.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
18	PDB:3kfeA	0.095	0.045	4.515	487	0.045	0.016	3kfeA.pdb.gz	Crystal structures of a group II chaperonin reveal the open and closed states associated with the protein folding cycle.
19	PDB:2kogA	0.135	0.178	4.829	116	0.090	0.138	2kogA.pdb.gz
20	PDB:6fvtU	0.171	0.111	4.829	304	0.118	0.069	6fvtU.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03135	7.93e-133	370	178	1.000	1.000	CAV1_HUMAN Caveolin-1 OS=Homo sapiens OX=9606 GN=CAV1 PE=1 SV=4
2	Q6RVA9	7.23e-130	363	178	0.961	0.961	CAV1_PIG Caveolin-1 OS=Sus scrofa OX=9823 GN=CAV1 PE=2 SV=1
3	P33724	1.43e-129	362	178	0.961	0.961	CAV1_CANLF Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CAV1 PE=1 SV=1
4	P79132	2.31e-129	362	178	0.961	0.961	CAV1_BOVIN Caveolin-1 OS=Bos taurus OX=9913 GN=CAV1 PE=2 SV=1
5	P49817	5.52e-128	358	178	0.949	0.949	CAV1_MOUSE Caveolin-1 OS=Mus musculus OX=10090 GN=Cav1 PE=1 SV=1
6	P41350	3.02e-127	356	178	0.944	0.944	CAV1_RAT Caveolin-1 OS=Rattus norvegicus OX=10116 GN=Cav1 PE=1 SV=3
7	P35431	2.00e-116	329	178	0.865	0.865	CAV1_CHICK Caveolin-1 OS=Gallus gallus OX=9031 GN=CAV1 PE=2 SV=1
8	W5UMJ4	1.38e-94	274	180	0.730	0.722	W5UMJ4_ICTPU Caveolin OS=Ictalurus punctatus OX=7998 GN=cav1 PE=2 SV=1
9	Q6YLH9	5.80e-94	272	181	0.713	0.702	Q6YLH9_DANRE Caveolin OS=Danio rerio OX=7955 GN=CAV1 PE=1 SV=1
10	Q6YLH8	2.98e-85	249	148	0.640	0.770	Q6YLH8_DANRE Caveolin OS=Danio rerio OX=7955 GN=wu:fc07c04 PE=1 SV=1
11	Q6YLH7	1.09e-79	235	150	0.590	0.700	Q6YLH7_DANRE Caveolin OS=Danio rerio OX=7955 GN=im:6902906 PE=1 SV=1
12	P51637	9.23e-73	218	151	0.528	0.623	CAV3_MOUSE Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 SV=1
13	P51638	6.77e-72	215	151	0.517	0.609	CAV3_RAT Caveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 PE=1 SV=1
14	Q2KI43	7.80e-72	215	151	0.545	0.642	CAV3_BOVIN Caveolin-3 OS=Bos taurus OX=9913 GN=CAV3 PE=2 SV=1
15	P56539	1.94e-71	214	151	0.539	0.636	CAV3_HUMAN Caveolin-3 OS=Homo sapiens OX=9606 GN=CAV3 PE=1 SV=1
16	Q9WVC3	2.72e-29	107	162	0.292	0.321	CAV2_MOUSE Caveolin-2 OS=Mus musculus OX=10090 GN=Cav2 PE=1 SV=1
17	Q2IBC5	2.84e-29	107	162	0.292	0.321	CAV2_RAT Caveolin-2 OS=Rattus norvegicus OX=10116 GN=Cav2 PE=1 SV=2
18	P51636	8.53e-29	106	162	0.287	0.315	CAV2_HUMAN Caveolin-2 OS=Homo sapiens OX=9606 GN=CAV2 PE=1 SV=2
19	Q66WT7	1.52e-27	103	162	0.281	0.309	CAV2_BOVIN Caveolin-2 OS=Bos taurus OX=9913 GN=CAV2 PE=1 SV=1
20	Q94051	4.78e-23	93.6	235	0.247	0.187	CAV1_CAEEL Caveolin-1 OS=Caenorhabditis elegans OX=6239 GN=cav-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01146 Caveolin	3.9e-55	196.9	Caveolin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000007138

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007142	0.996	May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity
2	60711.ENSCSAP00000012126	0.996	Receptor protein-tyrosine kinase
3	60711.ENSCSAP00000003062	0.995	Nitric oxide synthase 3 (endothelial cell)
4	60711.ENSCSAP00000009855	0.991	Tyrosine-protein kinase
5	60711.ENSCSAP00000011676	0.988	FYN proto-oncogene, Src family tyrosine kinase
6	60711.ENSCSAP00000006483	0.974	Heat shock protein 90kDa alpha (cytosolic), class A member 1
7	60711.ENSCSAP00000007617	0.948	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
8	60711.ENSCSAP00000008609	0.947	Heat shock protein 90kDa alpha (cytosolic), class B member 1
9	60711.ENSCSAP00000014827	0.933	Caveolae associated protein 1
10	60711.ENSCSAP00000007508	0.932	Transient receptor potential cation channel, subfamily C, member 1
11	60711.ENSCSAP00000010372	0.930	Estrogen receptor 1
12	60711.ENSCSAP00000018280	0.930	Prion protein
13	60711.ENSCSAP00000007285	0.919	Receptor protein serine/threonine kinase
14	60711.ENSCSAP00000015327	0.910	Receptor protein-tyrosine kinase
15	60711.ENSCSAP00000004889	0.902	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
16	60711.ENSCSAP00000012999	0.893	Tyrosine-protein kinase receptor
17	60711.ENSCSAP00000007641	0.892	Calmodulin 1 (phosphorylase kinase, delta)
18	60711.ENSCSAP00000000184	0.883	Belongs to the integrin beta chain family.
19	60711.ENSCSAP00000010383	0.883	C-src tyrosine kinase
20	60711.ENSCSAP00000009965	0.881	Estrogen receptor 2 (ER beta)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0019899	0.949	enzyme binding
GO:0044325	0.626	transmembrane transporter binding
GO:0098772	0.513	molecular function regulator activity
GO:0019900	0.501	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.996	cellular process
GO:0048583	0.996	regulation of response to stimulus
GO:0048518	0.996	positive regulation of biological process
GO:0065009	0.995	regulation of molecular function
GO:0051239	0.995	regulation of multicellular organismal process
GO:0048519	0.995	negative regulation of biological process
GO:0010646	0.995	regulation of cell communication
GO:0048523	0.994	negative regulation of cellular process
GO:0044092	0.993	negative regulation of molecular function
GO:0043271	0.993	negative regulation of monoatomic ion transport
GO:0065008	0.992	regulation of biological quality
GO:0048522	0.992	positive regulation of cellular process
GO:0031399	0.992	regulation of protein modification process
GO:0051716	0.991	cellular response to stimulus
GO:0051338	0.991	regulation of transferase activity
GO:0010959	0.991	regulation of metal ion transport
GO:0042325	0.991	regulation of phosphorylation
GO:0048878	0.990	chemical homeostasis
GO:0034762	0.989	regulation of transmembrane transport
GO:0022607	0.988	cellular component assembly
GO:0051179	0.985	localization
GO:1902531	0.985	regulation of intracellular signal transduction
GO:0060759	0.981	regulation of response to cytokine stimulus
GO:0044087	0.981	regulation of cellular component biogenesis
GO:1903522	0.980	regulation of blood circulation
GO:0009719	0.979	response to endogenous stimulus
GO:0006950	0.979	response to stress
GO:0009968	0.979	negative regulation of signal transduction
GO:0080134	0.978	regulation of response to stress
GO:0032409	0.977	regulation of transporter activity
GO:0051128	0.977	regulation of cellular component organization
GO:1904062	0.977	regulation of monoatomic cation transmembrane transport
GO:0006469	0.977	negative regulation of protein kinase activity
GO:0090257	0.975	regulation of muscle system process
GO:0043408	0.975	regulation of MAPK cascade
GO:0032501	0.973	multicellular organismal process
GO:1903115	0.973	regulation of actin filament-based movement
GO:0006942	0.971	regulation of striated muscle contraction
GO:0051641	0.970	cellular localization
GO:0006810	0.970	transport
GO:0051924	0.970	regulation of calcium ion transport
GO:0033036	0.969	macromolecule localization
GO:0008016	0.969	regulation of heart contraction
GO:0070887	0.967	cellular response to chemical stimulus
GO:0044091	0.966	membrane biogenesis
GO:0034766	0.962	negative regulation of monoatomic ion transmembrane transport
GO:0010033	0.961	response to organic substance
GO:0086004	0.961	regulation of cardiac muscle cell contraction
GO:0048856	0.957	anatomical structure development
GO:0071709	0.955	membrane assembly
GO:0010256	0.954	endomembrane system organization
GO:0007154	0.952	cell communication
GO:0071900	0.934	regulation of protein serine/threonine kinase activity
GO:0032101	0.933	regulation of response to external stimulus
GO:0042127	0.930	regulation of cell population proliferation
GO:0007009	0.930	plasma membrane organization
GO:0023052	0.929	signaling
GO:0040012	0.914	regulation of locomotion
GO:0009893	0.913	positive regulation of metabolic process
GO:0044238	0.908	primary metabolic process
GO:0008104	0.908	protein localization
GO:0043067	0.906	regulation of programmed cell death
GO:0042981	0.903	regulation of apoptotic process
GO:2000145	0.902	regulation of cell motility
GO:0051050	0.901	positive regulation of transport
GO:0048584	0.900	positive regulation of response to stimulus
GO:0044093	0.895	positive regulation of molecular function
GO:0003008	0.890	system process
GO:0071702	0.889	organic substance transport
GO:0010647	0.887	positive regulation of cell communication
GO:0023056	0.885	positive regulation of signaling
GO:0071495	0.884	cellular response to endogenous stimulus
GO:0051240	0.884	positive regulation of multicellular organismal process
GO:0031347	0.880	regulation of defense response
GO:0030334	0.869	regulation of cell migration
GO:0071704	0.868	organic substance metabolic process
GO:0051247	0.868	positive regulation of protein metabolic process
GO:0006897	0.865	endocytosis
GO:0009967	0.854	positive regulation of signal transduction
GO:0043066	0.852	negative regulation of apoptotic process
GO:0044237	0.850	cellular metabolic process
GO:0002831	0.831	regulation of response to biotic stimulus
GO:0007275	0.823	multicellular organism development
GO:0071310	0.822	cellular response to organic substance
GO:0031325	0.818	positive regulation of cellular metabolic process
GO:0048513	0.815	animal organ development
GO:0010468	0.761	regulation of gene expression
GO:0009628	0.759	response to abiotic stimulus
GO:0042391	0.756	regulation of membrane potential
GO:0007165	0.756	signal transduction
GO:1901700	0.748	response to oxygen-containing compound
GO:0010876	0.745	lipid localization
GO:0009889	0.735	regulation of biosynthetic process
GO:0031326	0.726	regulation of cellular biosynthetic process
GO:0050793	0.718	regulation of developmental process
GO:0030154	0.717	cell differentiation
GO:0006996	0.713	organelle organization
GO:0045595	0.709	regulation of cell differentiation
GO:0002682	0.697	regulation of immune system process
GO:0072657	0.667	protein localization to membrane
GO:0048731	0.646	system development
GO:1990778	0.643	protein localization to cell periphery
GO:0009725	0.631	response to hormone
GO:0009653	0.608	anatomical structure morphogenesis
GO:0009605	0.604	response to external stimulus
GO:0006807	0.600	nitrogen compound metabolic process
GO:0070482	0.534	response to oxygen levels
GO:0019725	0.513	cellular homeostasis
GO:0030003	0.504	intracellular monoatomic cation homeostasis
GO:0050776	0.496	regulation of immune response
GO:0098771	0.495	inorganic ion homeostasis
GO:0010556	0.461	regulation of macromolecule biosynthetic process
GO:0045088	0.445	regulation of innate immune response
GO:0007166	0.433	cell surface receptor signaling pathway
GO:0016050	0.373	vesicle organization
GO:0043170	0.346	macromolecule metabolic process
GO:0019219	0.332	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.318	regulation of DNA-templated transcription
GO:0070836	0.302	caveola assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005901	0.997	caveola
GO:0043226	0.959	organelle
GO:0005622	0.958	intracellular anatomical structure
GO:0012505	0.934	endomembrane system
GO:0043229	0.921	intracellular organelle
GO:0043227	0.917	membrane-bounded organelle
GO:0031982	0.857	vesicle
GO:0043231	0.828	intracellular membrane-bounded organelle
GO:0005737	0.823	cytoplasm
GO:0032991	0.595	protein-containing complex
GO:0031410	0.426	cytoplasmic vesicle
GO:0031090	0.315	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]