StarFunc result for job id Q03164

User Input

>input (1400 residues)
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAV
AAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSA
AIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKD
ISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIV
RRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSR
IIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSS
SPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPAS
TAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPED
VGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSL
SISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFT
PGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKI
LIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTD
KRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKA
PQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWM
PSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVP
KTTPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNIL
STLSNGNSSKQKIPADGVHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96QE3	0.035	0.030	1.016E-4	1844	0.163	0.124	Q96QE3.pdb.gz	ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4
2	AFDB:A8JR05	0.040	0.028	2.303E-3	2351	0.162	0.097	A8JR05.pdb.gz	A8JR05_DROME Crossveinless c, isoform C OS=Drosophila melanogaster OX=7227 GN=cv-c PE=4 SV=1
3	AFDB:O75128	0.032	0.034	5.271E-3	1261	0.120	0.133	O75128.pdb.gz	COBL_HUMAN Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2
4	AFDB:Q4QY64	0.038	0.028	5.618E-3	1826	0.144	0.111	Q4QY64.pdb.gz	ATAD5_MOUSE ATPase family AAA domain-containing protein 5 OS=Mus musculus OX=10090 GN=Atad5 PE=1 SV=1
5	AFDB:A0A1D8PD43	0.038	0.034	5.988E-3	1655	0.150	0.127	A0A1D8PD43.pdb.gz	A0A1D8PD43_CANAL Bni4p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNI4 PE=4 SV=1
6	AFDB:D4A7V6	0.032	0.025	6.381E-3	1962	0.157	0.112	D4A7V6.pdb.gz	D4A7V6_RAT Caspase 8 associated protein 2 OS=Rattus norvegicus OX=10116 GN=Casp8ap2 PE=1 SV=1
7	AFDB:Q8I398	0.026	0.022	6.801E-3	2112	0.115	0.076	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
8	AFDB:Q9HCM1	0.048	0.041	7.248E-3	1747	0.146	0.117	Q9HCM1.pdb.gz	RESF1_HUMAN Retroelement silencing factor 1 OS=Homo sapiens OX=9606 GN=RESF1 PE=1 SV=3
9	AFDB:P29617	0.039	0.039	1.062E-2	1703	0.138	0.113	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
10	AFDB:Q9VUB7	0.039	0.028	1.132E-2	2294	0.114	0.069	Q9VUB7.pdb.gz	Q9VUB7_DROME PAX transcription activation domain interacting protein OS=Drosophila melanogaster OX=7227 GN=Ptip PE=1 SV=3
11	PDB:7ktrJ	0.024	0.131	4.700	214	0.014	0.089	7ktrJ.pdb.gz	Structure of the human SAGA coactivator complex.
12	PDB:8escS	0.025	0.095	5.009	268	0.013	0.067	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
13	PDB:6n8jb	0.033	0.060	6.888	647	0.016	0.036	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
14	PDB:7r5jV0	0.023	0.087	7.341	273	0.011	0.055	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:2p01A	0.027	0.089	7.824	323	0.020	0.087	2p01A.pdb.gz
16	PDB:7mqaNA	0.026	0.093	8.338	295	0.016	0.078	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7r0wJ	0.027	0.123	8.338	159	0.010	0.088	7r0wJ.pdb.gz	Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
18	PDB:5gm6P	0.029	0.097	8.887	246	0.022	0.126	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3ISN4	0.0	564	606	0.226	0.523	A0A3B3ISN4_HUMAN Lysine methyltransferase 2A (Fragment) OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=2
2	E9PR05	0.0	2744	1439	1.000	0.973	E9PR05_HUMAN Lysine methyltransferase 2A (Fragment) OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=2
3	F1M0L3	0.0	2022	3986	0.935	0.328	F1M0L3_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2a PE=1 SV=4
4	P55200	0.0	2024	3966	0.925	0.327	KMT2A_MOUSE Histone-lysine N-methyltransferase 2A OS=Mus musculus OX=10090 GN=Kmt2a PE=1 SV=3
5	Q03164	0.0	2773	3969	1.000	0.353	KMT2A_HUMAN Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5
6	F1QL52	2.40e-164	551	4219	0.308	0.102	F1QL52_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
7	A8VKP8	7.30e-162	543	4218	0.307	0.102	A8VKP8_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
8	O08550	3.85e-28	126	2713	0.066	0.034	KMT2B_MOUSE Histone-lysine N-methyltransferase 2B OS=Mus musculus OX=10090 GN=Kmt2b PE=1 SV=3
9	Q9UMN6	1.19e-27	125	2715	0.069	0.036	KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1
10	A0A8I6A3W5	3.45e-07	57.4	621	0.018	0.040	A0A8I6A3W5_RAT Methyl-CpG binding domain protein 1 OS=Rattus norvegicus OX=10116 GN=Mbd1 PE=4 SV=1
11	Q9Z2E2	3.59e-07	57.4	636	0.018	0.039	MBD1_MOUSE Methyl-CpG-binding domain protein 1 OS=Mus musculus OX=10090 GN=Mbd1 PE=1 SV=2
12	A0A8I6AS94	3.93e-07	57.0	614	0.018	0.041	A0A8I6AS94_RAT Methyl-CpG binding domain protein 1 OS=Rattus norvegicus OX=10116 GN=Mbd1 PE=4 SV=1
13	A0A2R8Q4R6	6.20e-07	57.0	2052	0.018	0.012	A0A2R8Q4R6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=si:ch211-220a11.1 PE=1 SV=1
14	Q9UIS9	7.72e-07	56.2	605	0.018	0.041	MBD1_HUMAN Methyl-CpG-binding domain protein 1 OS=Homo sapiens OX=9606 GN=MBD1 PE=1 SV=2
15	F1RCN0	1.11e-06	55.8	1500	0.018	0.017	F1RCN0_DANRE DNA (cytosine-5)-methyltransferase OS=Danio rerio OX=7955 GN=cb1075 PE=1 SV=1
16	Q9P0U4	3.65e-06	53.9	656	0.016	0.035	CXXC1_HUMAN CXXC-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CXXC1 PE=1 SV=2
17	F7EKZ5	3.83e-06	53.9	631	0.016	0.036	F7EKZ5_RAT CXXC-type zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Cxxc1 PE=1 SV=1
18	A1A5S2	4.30e-06	53.5	660	0.016	0.035	A1A5S2_RAT CXXC-type zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Cxxc1 PE=2 SV=1
19	Q9CWW7	4.30e-06	53.5	660	0.016	0.035	CXXC1_MOUSE CXXC-type zinc finger protein 1 OS=Mus musculus OX=10090 GN=Cxxc1 PE=1 SV=1
20	A0A669KB29	4.37e-06	53.5	647	0.016	0.036	A0A669KB29_HUMAN CXXC-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CXXC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02008 zf-CXXC	2e-10	51.9	CXXC zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436786

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264515	0.999	Retinoblastoma-binding protein 5
2	9606.ENSP00000337088	0.999	Menin
3	9606.ENSP00000340896	0.999	Set1/Ash2 histone methyltransferase complex subunit ASH2
4	9606.ENSP00000351446	0.999	WD repeat-containing protein 5
5	9606.ENSP00000262367	0.992	CREB-binding protein
6	9606.ENSP00000309555	0.988	Host cell factor 1
7	9606.ENSP00000345837	0.980	Protein dpy-30 homolog
8	9606.ENSP00000370109	0.969	PC4 and SFRS1-interacting protein
9	9606.ENSP00000382863	0.969	Chromodomain-helicase-DNA-binding protein 8
10	9606.ENSP00000339992	0.963	Transcriptional activator Myb
11	9606.ENSP00000399982	0.958	Transcription initiation factor TFIID subunit 6
12	9606.ENSP00000406549	0.958	Transcription initiation factor TFIID subunit 1
13	9606.ENSP00000244537	0.957	Histone cluster 1 H4 family member f
14	9606.ENSP00000356480	0.951	E3 ubiquitin-protein ligase RING2
15	9606.ENSP00000370193	0.950	Transcription initiation factor TFIID subunit 9
16	9606.ENSP00000263253	0.949	Histone acetyltransferase p300
17	9606.ENSP00000406037	0.946	Histone acetyltransferase KAT8
18	9606.ENSP00000301067	0.942	Histone-lysine N-methyltransferase 2D
19	9606.ENSP00000363124	0.941	PHD finger protein 20
20	9606.ENSP00000363944	0.938	Ribosomal biogenesis protein LAS1L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0042800	1.000	histone H3K4 methyltransferase activity
GO:0043167	0.451	ion binding
GO:0043565	0.325	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.965	biological regulation
GO:0080090	0.954	regulation of primary metabolic process
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0071704	0.929	organic substance metabolic process
GO:0051171	0.927	regulation of nitrogen compound metabolic process
GO:0044238	0.922	primary metabolic process
GO:0032259	0.915	methylation
GO:0043414	0.913	macromolecule methylation
GO:0008213	0.909	protein alkylation
GO:0050896	0.906	response to stimulus
GO:0031323	0.887	regulation of cellular metabolic process
GO:0018205	0.885	peptidyl-lysine modification
GO:0018022	0.880	peptidyl-lysine methylation
GO:0007275	0.860	multicellular organism development
GO:0002376	0.846	immune system process
GO:0030097	0.776	hemopoiesis
GO:0010468	0.538	regulation of gene expression
GO:0019219	0.465	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.462	regulation of biosynthetic process
GO:0048518	0.453	positive regulation of biological process
GO:0048513	0.385	animal organ development
GO:0010556	0.332	regulation of macromolecule biosynthetic process
GO:0031326	0.330	regulation of cellular biosynthetic process
GO:0051252	0.330	regulation of RNA metabolic process
GO:0006357	0.324	regulation of transcription by RNA polymerase II
GO:0045935	0.317	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.307	positive regulation of macromolecule biosynthetic process
GO:0016570	0.305	histone modification
GO:0031328	0.300	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.995	cytoplasm
GO:0005829	0.980	cytosol
GO:0032991	0.309	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:60260	1.000	L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine
EC:2.1.1.354	1.000	[histone H3]-lysine(4) N-trimethyltransferase.

[back to server]