StarFunc result for job id Q03167

User Input

>input (851 residues)
MTSHYVIAIFALMSSCLATAGPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGL
PQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVHIHHKSVVFLLNSPHPLVWHLKTERLA
TGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEYGAVTSFTELKIA
RNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITP
NSNPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSI
GFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAE
EMGDEEVHTIPPELRILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDG
LPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDV
TLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGY
EDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNT
DLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENIC
PKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKL
PKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFH
GLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGST
QSTPCSSSSTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26342	0.852	0.850	0.000	853	0.811	0.809	P26342.pdb.gz	TGBR3_RAT Transforming growth factor beta receptor type 3 OS=Rattus norvegicus OX=10116 GN=Tgfbr3 PE=1 SV=1
2	AFDB:P35054	0.696	0.698	0.000	848	0.840	0.843	P35054.pdb.gz	TGBR3_PIG Transforming growth factor beta receptor type 3 OS=Sus scrofa OX=9823 GN=TGFBR3 PE=2 SV=1
3	AFDB:Q03167	1.000	1.000	0.000	851	1.000	1.000	Q03167.pdb.gz	TGBR3_HUMAN Transforming growth factor beta receptor type 3 OS=Homo sapiens OX=9606 GN=TGFBR3 PE=1 SV=3
4	AFDB:Q90998	0.418	0.423	0.000	841	0.667	0.675	Q90998.pdb.gz	Q90998_CHICK Transforming growth factor beta receptor 3 OS=Gallus gallus OX=9031 GN=TGFBR3 PE=1 SV=1
5	AFDB:A0A0H3UK16	0.411	0.412	1.131E-95	848	0.488	0.489	A0A0H3UK16.pdb.gz	A0A0H3UK16_DANRE Transforming growth factor beta receptor III OS=Danio rerio OX=7955 GN=si:ch73-18k18.1 PE=2 SV=1
6	PDB:5hzwA	0.234	0.283	1.429E-15	668	0.080	0.102	5hzwA.pdb.gz	Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
7	AFDB:Q5DID3	0.151	0.100	1.320E-14	1319	0.090	0.058	Q5DID3.pdb.gz	UROL1_MOUSE Uromodulin-like 1 OS=Mus musculus OX=10090 GN=Umodl1 PE=1 SV=1
8	PDB:4wrnB	0.144	0.181	4.065E-13	663	0.063	0.081	4wrnB.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
9	AFDB:Q8IRK0	0.149	0.250	7.209E-13	462	0.081	0.149	Q8IRK0.pdb.gz	Q8IRK0_DROME GH04558p OS=Drosophila melanogaster OX=7227 GN=pio PE=2 SV=1
10	PDB:5hzvA	0.132	0.184	1.051E-12	598	0.067	0.095	5hzvA.pdb.gz	Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
11	PDB:4wrnA	0.157	0.190	1.915E-12	693	0.063	0.078	4wrnA.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
12	AFDB:G4SNP7	0.140	0.090	1.070E-10	1427	0.080	0.048	G4SNP7.pdb.gz	G4SNP7_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=3
13	AFDB:G5EC82	0.135	0.157	4.774E-8	711	0.062	0.075	G5EC82.pdb.gz	G5EC82_CAEEL Transmembrane protein RAM-5 OS=Caenorhabditis elegans OX=6239 GN=ram-5 PE=2 SV=1
14	AFDB:Q9VPG1	0.120	0.048	5.019E-8	2284	0.086	0.032	Q9VPG1.pdb.gz	Q9VPG1_DROME Zye OS=Drosophila melanogaster OX=7227 GN=zye PE=4 SV=1
15	PDB:3k6sC	0.100	0.097	1.195E-3	885	0.061	0.059	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
16	PDB:7d56C	0.086	0.111	2.660E-3	640	0.035	0.047	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
17	PDB:7sqcO0	0.086	0.067	4.847E-3	1140	0.039	0.029	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:5nqkB	0.100	0.281	5.095E-3	242	0.024	0.083	5nqkB.pdb.gz	human 199.16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2
19	PDB:7u05C	0.106	0.219	1.253E-2	286	0.035	0.105	7u05C.pdb.gz
20	PDB:7tvzE	0.083	0.102	1.456E-2	665	0.031	0.039	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0H3UK16	0.0	773	848	0.488	0.489	A0A0H3UK16_DANRE Transforming growth factor beta receptor III OS=Danio rerio OX=7955 GN=si:ch73-18k18.1 PE=2 SV=1
2	E7FDB6	0.0	776	848	0.486	0.488	E7FDB6_DANRE Transforming growth factor, beta receptor III OS=Danio rerio OX=7955 GN=tgfbr3 PE=1 SV=1
3	O88393	0.0	1428	850	0.817	0.818	TGBR3_MOUSE Transforming growth factor beta receptor type 3 OS=Mus musculus OX=10090 GN=Tgfbr3 PE=1 SV=1
4	P26342	0.0	1414	853	0.819	0.817	TGBR3_RAT Transforming growth factor beta receptor type 3 OS=Rattus norvegicus OX=10116 GN=Tgfbr3 PE=1 SV=1
5	P35054	0.0	1477	848	0.840	0.843	TGBR3_PIG Transforming growth factor beta receptor type 3 OS=Sus scrofa OX=9823 GN=TGFBR3 PE=2 SV=1
6	Q03167	0.0	1762	851	1.000	1.000	TGBR3_HUMAN Transforming growth factor beta receptor type 3 OS=Homo sapiens OX=9606 GN=TGFBR3 PE=1 SV=3
7	Q90998	0.0	1120	841	0.672	0.680	Q90998_CHICK Transforming growth factor beta receptor 3 OS=Gallus gallus OX=9031 GN=TGFBR3 PE=1 SV=1
8	Q6B0K7	3.15e-18	92.0	644	0.055	0.073	Q6B0K7_CHICK Endoglin OS=Gallus gallus OX=9031 PE=2 SV=1
9	Q6Q3E8	4.73e-17	88.2	650	0.126	0.165	Q6Q3E8_RAT Endoglin OS=Rattus norvegicus OX=10116 GN=Eng PE=4 SV=1
10	A0A8I6GL08	5.75e-17	87.8	639	0.129	0.172	A0A8I6GL08_RAT Endoglin OS=Rattus norvegicus OX=10116 GN=Eng PE=1 SV=1
11	Q63961	1.20e-16	86.7	653	0.123	0.161	EGLN_MOUSE Endoglin OS=Mus musculus OX=10090 GN=Eng PE=1 SV=2
12	P37176	9.84e-16	84.0	653	0.123	0.161	EGLN_PIG Endoglin OS=Sus scrofa OX=9823 GN=ENG PE=1 SV=1
13	Q3KR75	5.58e-13	75.1	699	0.130	0.159	Q3KR75_RAT Eng protein OS=Rattus norvegicus OX=10116 GN=Eng PE=2 SV=1
14	A0A8I6A813	8.11e-13	74.3	635	0.098	0.131	A0A8I6A813_RAT Endoglin OS=Rattus norvegicus OX=10116 GN=Eng PE=1 SV=1
15	F5GX88	3.39e-12	72.0	476	0.048	0.086	F5GX88_HUMAN Endoglin OS=Homo sapiens OX=9606 GN=ENG PE=1 SV=1
16	P17813	5.33e-12	72.0	658	0.048	0.062	EGLN_HUMAN Endoglin OS=Homo sapiens OX=9606 GN=ENG PE=1 SV=2
17	M0RA19	5.77e-11	68.6	622	0.106	0.145	M0RA19_RAT Endoglin OS=Rattus norvegicus OX=10116 GN=Eng PE=1 SV=3
18	A0A1Z2R986	1.49e-10	67.0	559	0.051	0.077	EGLN_DANRE Endoglin OS=Danio rerio OX=7955 GN=eng PE=2 SV=1
19	Q8CIZ5	1.66e-08	60.8	1418	0.092	0.055	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
20	Q60997	4.70e-08	59.7	2085	0.088	0.036	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00386 C1q	2.9e+02	13.1	C1q domain
2	PF05372 Delta_lysin	1.7e+02	12.9	Delta lysin family
3	PF00100 Zona_pellucida	1.7e-39	147.7	Zona pellucida-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000212355

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351905	0.997	TGF-beta receptor type-2
2	9606.ENSP00000221930	0.994	Transforming growth factor beta-1
3	9606.ENSP00000355896	0.991	Transforming growth factor beta-2
4	9606.ENSP00000238682	0.989	Transforming growth factor beta-3
5	9606.ENSP00000403701	0.982	Beta-arrestin-2
6	9606.ENSP00000364133	0.980	TGF-beta receptor type-1
7	9606.ENSP00000356954	0.938	Connective tissue growth factor
8	9606.ENSP00000364683	0.938	BMP and activin membrane-bound inhibitor homolog
9	9606.ENSP00000377027	0.931	Transforming growth factor-beta receptor-associated protein 1
10	9606.ENSP00000241416	0.923	Activin receptor type-2A
11	9606.ENSP00000383003	0.912	Peptidyl-prolyl cis-trans isomerase FKBP1A
12	9606.ENSP00000347379	0.905	Occludin
13	9606.ENSP00000219255	0.902	Partitioning defective 6 homolog alpha
14	9606.ENSP00000243786	0.900	Inhibin alpha chain
15	9606.ENSP00000346829	0.771	Protein wntless homolog
16	9606.ENSP00000264498	0.715	Fibroblast growth factor 2
17	9606.ENSP00000262160	0.629	Mothers against decapentaplegic homolog 2
18	9606.ENSP00000410689	0.598	Actin filament-associated protein 1
19	9606.ENSP00000332973	0.579	Mothers against decapentaplegic homolog 3
20	9606.ENSP00000302569	0.578	C-type lectin domain family 7 member A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005539	1.000	glycosaminoglycan binding
GO:0050431	1.000	transforming growth factor beta binding
GO:0005024	1.000	transforming growth factor beta receptor activity
GO:0005160	0.997	transforming growth factor beta receptor binding
GO:0046332	0.898	SMAD binding
GO:0070123	0.875	transforming growth factor beta receptor activity, type III
GO:0015026	0.607	coreceptor activity
GO:0042802	0.479	identical protein binding
GO:0005114	0.415	type II transforming growth factor beta receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0007165	0.981	signal transduction
GO:0032501	0.976	multicellular organismal process
GO:0032502	0.969	developmental process
GO:0071704	0.966	organic substance metabolic process
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0007178	0.962	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0070848	0.958	response to growth factor
GO:0071363	0.951	cellular response to growth factor stimulus
GO:0048856	0.949	anatomical structure development
GO:0006807	0.948	nitrogen compound metabolic process
GO:0023051	0.948	regulation of signaling
GO:0001837	0.944	epithelial to mesenchymal transition
GO:0048518	0.943	positive regulation of biological process
GO:0010646	0.940	regulation of cell communication
GO:0071559	0.939	response to transforming growth factor beta
GO:0010468	0.932	regulation of gene expression
GO:0044238	0.928	primary metabolic process
GO:0048519	0.922	negative regulation of biological process
GO:0071560	0.921	cellular response to transforming growth factor beta stimulus
GO:0048522	0.918	positive regulation of cellular process
GO:0007275	0.916	multicellular organism development
GO:0048523	0.914	negative regulation of cellular process
GO:0030509	0.913	BMP signaling pathway
GO:0007179	0.911	transforming growth factor beta receptor signaling pathway
GO:0072359	0.901	circulatory system development
GO:0043170	0.900	macromolecule metabolic process
GO:2000145	0.883	regulation of cell motility
GO:0007507	0.877	heart development
GO:0090092	0.873	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0080090	0.872	regulation of primary metabolic process
GO:0051171	0.871	regulation of nitrogen compound metabolic process
GO:0019538	0.871	protein metabolic process
GO:0090100	0.858	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0044237	0.857	cellular metabolic process
GO:0009653	0.853	anatomical structure morphogenesis
GO:0090287	0.843	regulation of cellular response to growth factor stimulus
GO:0031323	0.838	regulation of cellular metabolic process
GO:0017015	0.832	regulation of transforming growth factor beta receptor signaling pathway
GO:0036211	0.825	protein modification process
GO:0009889	0.815	regulation of biosynthetic process
GO:0003007	0.814	heart morphogenesis
GO:0009893	0.792	positive regulation of metabolic process
GO:0060317	0.711	cardiac epithelial to mesenchymal transition
GO:0042221	0.707	response to chemical
GO:0035295	0.680	tube development
GO:0009790	0.680	embryo development
GO:0033993	0.672	response to lipid
GO:0050793	0.669	regulation of developmental process
GO:0042127	0.668	regulation of cell population proliferation
GO:0010604	0.656	positive regulation of macromolecule metabolic process
GO:0006468	0.655	protein phosphorylation
GO:0003205	0.603	cardiac chamber development
GO:0051239	0.595	regulation of multicellular organismal process
GO:0019219	0.590	regulation of nucleobase-containing compound metabolic process
GO:0035239	0.585	tube morphogenesis
GO:0051252	0.557	regulation of RNA metabolic process
GO:0060429	0.543	epithelium development
GO:0051094	0.530	positive regulation of developmental process
GO:0010556	0.527	regulation of macromolecule biosynthetic process
GO:0031326	0.496	regulation of cellular biosynthetic process
GO:0006355	0.476	regulation of DNA-templated transcription
GO:0045595	0.473	regulation of cell differentiation
GO:0060389	0.466	pathway-restricted SMAD protein phosphorylation
GO:0030334	0.460	regulation of cell migration
GO:0009725	0.459	response to hormone
GO:0031325	0.448	positive regulation of cellular metabolic process
GO:0009892	0.441	negative regulation of metabolic process
GO:0051173	0.426	positive regulation of nitrogen compound metabolic process
GO:0009891	0.423	positive regulation of biosynthetic process
GO:0010605	0.395	negative regulation of macromolecule metabolic process
GO:0071840	0.368	cellular component organization or biogenesis
GO:0031328	0.333	positive regulation of cellular biosynthetic process
GO:0051240	0.332	positive regulation of multicellular organismal process
GO:0045935	0.316	positive regulation of nucleobase-containing compound metabolic process
GO:0065009	0.313	regulation of molecular function
GO:0048585	0.312	negative regulation of response to stimulus
GO:0010557	0.310	positive regulation of macromolecule biosynthetic process
GO:0016043	0.302	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.971	protein-containing complex
GO:0005622	0.968	intracellular anatomical structure
GO:0005576	0.949	extracellular region
GO:0043226	0.922	organelle
GO:0005737	0.917	cytoplasm
GO:0043231	0.914	intracellular membrane-bounded organelle
GO:0005615	0.845	extracellular space
GO:0043235	0.658	receptor complex
GO:0009986	0.569	cell surface
GO:0031012	0.515	extracellular matrix
GO:0012505	0.468	endomembrane system
GO:0062023	0.440	collagen-containing extracellular matrix
GO:0070013	0.345	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	1.000	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	1.000	receptor protein serine/threonine kinase.

[back to server]