StarFunc result for job id Q03181

User Input

>input (441 residues)
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03181	1.000	1.000	3.545E-61	441	1.000	1.000	Q03181.pdb.gz	PPARD_HUMAN Peroxisome proliferator-activated receptor delta OS=Homo sapiens OX=9606 GN=PPARD PE=1 SV=1
2	AFDB:F8W3D2	0.835	0.743	6.756E-46	496	0.701	0.623	F8W3D2.pdb.gz	F8W3D2_DANRE Peroxisome proliferator-activated receptor delta OS=Danio rerio OX=7955 GN=pparda PE=3 SV=1
3	AFDB:F1QJT0	0.612	0.572	1.106E-44	472	0.721	0.674	F1QJT0.pdb.gz
4	AFDB:F1D8S4	0.815	0.769	5.487E-43	468	0.635	0.598	F1D8S4.pdb.gz	F1D8S4_HUMAN Peroxisome proliferator-activated receptor alpha OS=Homo sapiens OX=9606 GN=NR1C1 PE=2 SV=1
5	AFDB:Q9I8W4	0.824	0.778	2.710E-42	468	0.626	0.590	Q9I8W4.pdb.gz	Q9I8W4_CHICK Peroxisome proliferator-activated receptor alpha OS=Gallus gallus OX=9031 GN=PPARalpha PE=2 SV=1
6	AFDB:A6XMH7	0.649	0.625	2.604E-41	459	0.621	0.597	A6XMH7.pdb.gz	A6XMH7_DANRE Peroxisome proliferator-activated receptor alpha OS=Danio rerio OX=7955 GN=ppara PE=2 SV=1
7	AFDB:O88275	0.827	0.725	2.394E-40	505	0.571	0.499	O88275.pdb.gz	PPARG_RAT Peroxisome proliferator-activated receptor gamma OS=Rattus norvegicus OX=10116 GN=Pparg PE=1 SV=2
8	AFDB:A6XMH6	0.807	0.678	1.694E-38	527	0.524	0.438	A6XMH6.pdb.gz	A6XMH6_DANRE Peroxisome proliferator-activated receptor gamma OS=Danio rerio OX=7955 GN=PPAR[g] PE=2 SV=1
9	AFDB:E2IH99	0.796	0.602	7.727E-36	587	0.519	0.390	E2IH99.pdb.gz	E2IH99_ONCMY Peroxisome proliferator-activated receptor gamma OS=Oncorhynchus mykiss OX=8022 GN=PPARg PE=2 SV=1
10	AFDB:P13055	0.457	0.151	2.497E-21	1412	0.293	0.091	P13055.pdb.gz	E75BB_DROME Ecdysone-induced protein 75B, isoform B OS=Drosophila melanogaster OX=7227 GN=Eip75B PE=2 SV=2
11	PDB:3dzyA	0.392	0.561	5.655E-14	302	0.231	0.338	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.485	0.872	2.479E-10	238	0.127	0.235	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.380	0.648	6.700E-6	246	0.102	0.183	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.406	0.665	1.369E-4	259	0.091	0.154	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:1szqA	0.100	0.096	6.556E-1	473	0.061	0.057	1szqA.pdb.gz
16	PDB:7cbbA	0.121	0.102	6.556E-1	576	0.066	0.050	7cbbA.pdb.gz	Structural and Biochemical Characterization of SbnC as a Representative Type B Siderophore Synthetase.
17	PDB:5gtmB	0.089	0.080	7.830E-1	522	0.086	0.073	5gtmB.pdb.gz
18	PDB:2bb5A	0.120	0.126	1.457	409	0.061	0.066	2bb5A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
19	PDB:7f53R	0.123	0.166	1.457	273	0.082	0.132	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
20	PDB:6p25A	0.127	0.085	1.592	731	0.057	0.034	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVK6	0.0	581	342	0.630	0.813	A0A0G2JVK6_RAT Peroxisome proliferator-activated receptor delta OS=Rattus norvegicus OX=10116 GN=Ppard PE=4 SV=1
2	A0A494C0T3	0.0	532	371	0.553	0.658	A0A494C0T3_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=1
3	A6XMH7	0.0	559	459	0.617	0.593	A6XMH7_DANRE Peroxisome proliferator-activated receptor alpha OS=Danio rerio OX=7955 GN=ppara PE=2 SV=1
4	E9PFV2	0.0	533	475	0.565	0.524	E9PFV2_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=2
5	F1D8S4	0.0	577	468	0.630	0.594	F1D8S4_HUMAN Peroxisome proliferator-activated receptor alpha OS=Homo sapiens OX=9606 GN=NR1C1 PE=2 SV=1
6	F8W3D2	0.0	651	496	0.701	0.623	F8W3D2_DANRE Peroxisome proliferator-activated receptor delta OS=Danio rerio OX=7955 GN=pparda PE=3 SV=1
7	K7DY57	0.0	559	459	0.617	0.593	K7DY57_DANRE Peroxisome proliferator-activated receptor alpha OS=Danio rerio OX=7955 GN=PPAR[a] PE=3 SV=1
8	O62807	0.0	531	504	0.562	0.492	PPARG_PIG Peroxisome proliferator-activated receptor gamma OS=Sus scrofa OX=9823 GN=PPARG PE=2 SV=1
9	O88275	0.0	528	505	0.558	0.487	PPARG_RAT Peroxisome proliferator-activated receptor gamma OS=Rattus norvegicus OX=10116 GN=Pparg PE=1 SV=2
10	P23204	0.0	557	468	0.587	0.553	PPARA_MOUSE Peroxisome proliferator-activated receptor alpha OS=Mus musculus OX=10090 GN=Ppara PE=1 SV=2
11	P35396	0.0	825	440	0.916	0.918	PPARD_MOUSE Peroxisome proliferator-activated receptor delta OS=Mus musculus OX=10090 GN=Ppard PE=1 SV=1
12	P37230	0.0	558	468	0.587	0.553	PPARA_RAT Peroxisome proliferator-activated receptor alpha OS=Rattus norvegicus OX=10116 GN=Ppara PE=1 SV=1
13	P37231	0.0	534	505	0.565	0.493	PPARG_HUMAN Peroxisome proliferator-activated receptor gamma OS=Homo sapiens OX=9606 GN=PPARG PE=1 SV=3
14	P37238	0.0	527	505	0.556	0.485	PPARG_MOUSE Peroxisome proliferator-activated receptor gamma OS=Mus musculus OX=10090 GN=Pparg PE=1 SV=3
15	Q03181	0.0	922	441	1.000	1.000	PPARD_HUMAN Peroxisome proliferator-activated receptor delta OS=Homo sapiens OX=9606 GN=PPARD PE=1 SV=1
16	Q07869	0.0	577	468	0.630	0.594	PPARA_HUMAN Peroxisome proliferator-activated receptor alpha OS=Homo sapiens OX=9606 GN=PPARA PE=1 SV=2
17	Q9I8W4	0.0	574	468	0.615	0.579	Q9I8W4_CHICK Peroxisome proliferator-activated receptor alpha OS=Gallus gallus OX=9031 GN=PPARalpha PE=2 SV=1
18	Q9MZG4	0.0	822	441	0.884	0.884	Q9MZG4_PIG Peroxisome proliferator activated receptor beta (Fragment) OS=Sus scrofa OX=9823 GN=PPARbeta PE=2 SV=1
19	Q9N135	0.0	550	468	0.617	0.581	Q9N135_PIG Peroxisome proliferator-activated receptor alpha (Fragment) OS=Sus scrofa OX=9823 GN=PPARalpha PE=2 SV=1
20	A6XMH6	2.93e-166	479	527	0.508	0.425	A6XMH6_DANRE Peroxisome proliferator-activated receptor gamma OS=Danio rerio OX=7955 GN=PPAR[g] PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	3e-13	61.4	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	9.4e-25	98.2	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310928

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419692	0.975	Retinoic acid receptor RXR-alpha
2	9606.ENSP00000262367	0.969	CREB-binding protein
3	9606.ENSP00000363817	0.953	Retinoic acid receptor RXR-beta
4	9606.ENSP00000264867	0.947	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
5	9606.ENSP00000344456	0.941	Catenin beta-1
6	9606.ENSP00000352900	0.940	Retinoic acid receptor RXR-gamma
7	9606.ENSP00000268712	0.925	Nuclear receptor corepressor 1
8	9606.ENSP00000297258	0.925	Fatty acid-binding protein, epidermal
9	9606.ENSP00000307241	0.916	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
10	9606.ENSP00000257555	0.914	Hepatocyte nuclear factor 1-alpha
11	9606.ENSP00000365682	0.914	Transducin-like enhancer protein 1
12	9606.ENSP00000290921	0.912	C-terminal-binding protein 1
13	9606.ENSP00000341551	0.912	Mothers against decapentaplegic homolog 4
14	9606.ENSP00000227868	0.909	Pyruvate dehydrogenase protein X component, mitochondrial
15	9606.ENSP00000205402	0.901	Dihydrolipoyl dehydrogenase, mitochondrial
16	9606.ENSP00000280346	0.901	Dihydrolipoamide S-acetyltransferase
17	9606.ENSP00000295266	0.900	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
18	9606.ENSP00000369134	0.900	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
19	9606.ENSP00000385216	0.889	Nuclear receptor coactivator 1
20	9606.ENSP00000384018	0.873	Nuclear receptor corepressor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	1.000	sequence-specific DNA binding
GO:0038023	0.999	signaling receptor activity
GO:0098531	0.996	ligand-activated transcription factor activity
GO:0004879	0.987	nuclear receptor activity
GO:0008134	0.922	transcription factor binding
GO:0003690	0.907	double-stranded DNA binding
GO:1990837	0.840	sequence-specific double-stranded DNA binding
GO:0008289	0.743	lipid binding
GO:0140297	0.642	DNA-binding transcription factor binding
GO:0000976	0.632	transcription cis-regulatory region binding
GO:0043167	0.590	ion binding
GO:0036094	0.554	small molecule binding
GO:0043168	0.543	anion binding
GO:0033293	0.503	monocarboxylic acid binding
GO:0003707	0.457	nuclear steroid receptor activity
GO:0001221	0.363	transcription coregulator binding
GO:0001223	0.333	transcription coactivator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0080090	0.979	regulation of primary metabolic process
GO:0031325	0.977	positive regulation of cellular metabolic process
GO:0051252	0.969	regulation of RNA metabolic process
GO:0010556	0.953	regulation of macromolecule biosynthetic process
GO:0050896	0.944	response to stimulus
GO:0008152	0.932	metabolic process
GO:0031326	0.931	regulation of cellular biosynthetic process
GO:0010468	0.924	regulation of gene expression
GO:0044238	0.908	primary metabolic process
GO:0071704	0.901	organic substance metabolic process
GO:0006355	0.896	regulation of DNA-templated transcription
GO:0032502	0.842	developmental process
GO:0032501	0.765	multicellular organismal process
GO:0044237	0.756	cellular metabolic process
GO:0048856	0.744	anatomical structure development
GO:0010604	0.673	positive regulation of macromolecule metabolic process
GO:0051716	0.632	cellular response to stimulus
GO:0048519	0.504	negative regulation of biological process
GO:0051173	0.464	positive regulation of nitrogen compound metabolic process
GO:0007154	0.459	cell communication
GO:0031328	0.455	positive regulation of cellular biosynthetic process
GO:0045935	0.451	positive regulation of nucleobase-containing compound metabolic process
GO:0023052	0.448	signaling
GO:0048523	0.448	negative regulation of cellular process
GO:0006357	0.442	regulation of transcription by RNA polymerase II
GO:0019216	0.441	regulation of lipid metabolic process
GO:0010557	0.438	positive regulation of macromolecule biosynthetic process
GO:0042221	0.428	response to chemical
GO:0007165	0.426	signal transduction
GO:0062012	0.425	regulation of small molecule metabolic process
GO:1902680	0.401	positive regulation of RNA biosynthetic process
GO:0045893	0.388	positive regulation of DNA-templated transcription
GO:0010565	0.366	regulation of cellular ketone metabolic process
GO:0009892	0.363	negative regulation of metabolic process
GO:0048513	0.336	animal organ development
GO:0062013	0.320	positive regulation of small molecule metabolic process
GO:0006807	0.310	nitrogen compound metabolic process
GO:0006629	0.309	lipid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0043232	0.719	intracellular non-membrane-bounded organelle
GO:0005737	0.702	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]