StarFunc result for job id Q03393

User Input

>input (145 residues)
MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVH
GEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQK
VLPVGVLYKVKVYETDNNIVVYKGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03393	1.000	1.000	6.027E-31	145	1.000	1.000	Q03393.pdb.gz	PTPS_HUMAN 6-pyruvoyl tetrahydrobiopterin synthase OS=Homo sapiens OX=9606 GN=PTS PE=1 SV=1
2	PDB:3i2bA	0.946	0.994	1.031E-28	138	0.952	1.000	3i2bA.pdb.gz
3	AFDB:P27213	0.966	0.972	1.095E-27	144	0.814	0.819	P27213.pdb.gz	PTPS_RAT 6-pyruvoyl tetrahydrobiopterin synthase OS=Rattus norvegicus OX=10116 GN=Pts PE=1 SV=1
4	PDB:1b66A	0.939	0.987	2.490E-26	138	0.800	0.841	1b66A.pdb.gz	Crystallographic and kinetic investigations on the mechanism of 6-pyruvoyl tetrahydropterin synthase.
5	AFDB:P48611	0.926	0.802	3.850E-21	168	0.545	0.470	P48611.pdb.gz	PTPS_DROME 6-pyruvoyl tetrahydrobiopterin synthase OS=Drosophila melanogaster OX=7227 GN=pr PE=1 SV=1
6	AFDB:O02058	0.926	0.958	3.086E-20	140	0.497	0.514	O02058.pdb.gz	PTPS_CAEEL Putative 6-pyruvoyl tetrahydrobiopterin synthase OS=Caenorhabditis elegans OX=6239 GN=ptps-1 PE=1 SV=2
7	PDB:2g64A	0.924	0.957	2.902E-19	140	0.497	0.514	2g64A.pdb.gz	Crystal Structure of Caenorhabditis Elegans 6-Pyruvoyl Tetrahydropterin Synthase
8	AFDB:Q1ZXI0	0.908	0.974	1.123E-18	135	0.462	0.496	Q1ZXI0.pdb.gz	PTPS_DICDI 6-pyruvoyl tetrahydrobiopterin synthase OS=Dictyostelium discoideum OX=44689 GN=ptsA PE=3 SV=1
9	PDB:4ntkA	0.753	0.895	1.194E-11	121	0.276	0.331	4ntkA.pdb.gz	Biochemical and Structural Studies of 6-Carboxy-5,6,7,8-tetrahydropterin Synthase Reveal the Molecular Basis of Catalytic Promiscuity within the Tunnel-fold Superfamily.
10	AFDB:P65870	0.754	0.896	2.972E-11	121	0.283	0.339	P65870.pdb.gz	QUED_ECOLI 6-carboxy-5,6,7,8-tetrahydropterin synthase OS=Escherichia coli (strain K12) OX=83333 GN=queD PE=1 SV=1
11	PDB:1b9lA	0.451	0.526	2.160E-2	119	0.110	0.134	1b9lA.pdb.gz
12	AFDB:A0A0H2ZEG5	0.482	0.553	3.924E-2	123	0.090	0.106	A0A0H2ZEG5.pdb.gz	A0A0H2ZEG5_PSEAB D-erythro-7,8-dihydroneopterin triphosphate epimerase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=folX PE=1 SV=1
13	PDB:7pzyC	0.263	0.204	5.224E-2	214	0.083	0.056	7pzyC.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
14	PDB:4v6wAB	0.290	0.221	6.312E-2	220	0.117	0.077	4v6wAB.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	AFDB:Q58185	0.429	0.239	8.364E-2	313	0.138	0.064	Q58185.pdb.gz	MPTA_METJA GTP cyclohydrolase MptA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=mptA PE=1 SV=2
16	PDB:7mq8NM	0.211	0.163	9.215E-2	233	0.069	0.043	7mq8NM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	AFDB:P40910	0.274	0.188	1.146E-1	256	0.103	0.059	P40910.pdb.gz	RS3A_CANAL Small ribosomal subunit protein eS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RPS1 PE=1 SV=3
18	PDB:4aeyA	0.473	0.612	1.263E-1	107	0.097	0.131	4aeyA.pdb.gz
19	PDB:4n3oA	0.185	0.099	2.092E-1	328	0.117	0.052	4n3oA.pdb.gz	2.4 Angstrom Resolution Crystal Structure of Putative Sugar Kinase from Campylobacter jejuni.
20	AFDB:Q54LT2	0.332	0.204	3.567E-1	287	0.103	0.052	Q54LT2.pdb.gz	URIC_DICDI Uricase OS=Dictyostelium discoideum OX=44689 GN=uox PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03393	1.74e-107	303	145	1.000	1.000	PTPS_HUMAN 6-pyruvoyl tetrahydrobiopterin synthase OS=Homo sapiens OX=9606 GN=PTS PE=1 SV=1
2	P27213	2.47e-82	240	144	0.772	0.778	PTPS_RAT 6-pyruvoyl tetrahydrobiopterin synthase OS=Rattus norvegicus OX=10116 GN=Pts PE=1 SV=1
3	Q9R1Z7	4.72e-82	239	144	0.766	0.771	PTPS_MOUSE 6-pyruvoyl tetrahydrobiopterin synthase OS=Mus musculus OX=10090 GN=Pts PE=1 SV=2
4	P48611	6.70e-51	161	168	0.538	0.464	PTPS_DROME 6-pyruvoyl tetrahydrobiopterin synthase OS=Drosophila melanogaster OX=7227 GN=pr PE=1 SV=1
5	O02058	7.64e-43	140	140	0.490	0.507	PTPS_CAEEL Putative 6-pyruvoyl tetrahydrobiopterin synthase OS=Caenorhabditis elegans OX=6239 GN=ptps-1 PE=1 SV=2
6	Q1ZXI0	1.34e-41	137	135	0.462	0.496	PTPS_DICDI 6-pyruvoyl tetrahydrobiopterin synthase OS=Dictyostelium discoideum OX=44689 GN=ptsA PE=3 SV=1
7	P65870	3.01e-12	61.6	121	0.290	0.347	QUED_ECOLI 6-carboxy-5,6,7,8-tetrahydropterin synthase OS=Escherichia coli (strain K12) OX=83333 GN=queD PE=1 SV=1
8	Q09779	9.5	28.9	1628	0.090	0.008	THO2_SCHPO THO complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tho2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01242 PTPS	9.4e-33	124.2	6-pyruvoyl tetrahydropterin synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280362

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419045	0.977	GTP cyclohydrolase 1
2	9606.ENSP00000234454	0.975	Sepiapterin reductase
3	9606.ENSP00000264399	0.918	cGMP-dependent protein kinase 2
4	9606.ENSP00000285930	0.911	Aldose reductase
5	9606.ENSP00000352584	0.905	Aldo-keto reductase family 1 member B10
6	9606.ENSP00000360683	0.905	Tyrosine-protein phosphatase non-receptor type 1
7	9606.ENSP00000290349	0.903	Carbonyl reductase [NADPH] 1
8	9606.ENSP00000363973	0.903	Alkaline phosphatase, tissue-nonspecific isozyme
9	9606.ENSP00000369927	0.902	Aldo-keto reductase family 1 member C3
10	9606.ENSP00000295463	0.901	Alkaline phosphatase, intestinal
11	9606.ENSP00000295453	0.900	Alkaline phosphatase, placental like 2
12	9606.ENSP00000375881	0.900	Alkaline phosphatase, placental
13	9606.ENSP00000260447	0.874	GTP cyclohydrolase 1 feedback regulatory protein
14	9606.ENSP00000340944	0.854	Tyrosine-protein phosphatase non-receptor type 11
15	9606.ENSP00000311857	0.853	Tyrosine-protein phosphatase non-receptor type 2
16	9606.ENSP00000369756	0.822	Receptor-type tyrosine-protein phosphatase alpha
17	9606.ENSP00000248594	0.808	Tyrosine-protein phosphatase non-receptor type 12
18	9606.ENSP00000452746	0.807	Proline-serine-threonine phosphatase-interacting protein 1
19	9606.ENSP00000349932	0.787	Receptor-type tyrosine-protein phosphatase S
20	9606.ENSP00000309116	0.781	Tyrosine-protein phosphatase non-receptor type 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003874	1.000	6-pyruvoyltetrahydropterin synthase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.978	organic substance metabolic process
GO:0044237	0.976	cellular metabolic process
GO:1901615	0.974	organic hydroxy compound metabolic process
GO:0044281	0.971	small molecule metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0034312	0.959	diol biosynthetic process
GO:1901564	0.952	organonitrogen compound metabolic process
GO:0042558	0.918	pteridine-containing compound metabolic process
GO:0042559	0.912	pteridine-containing compound biosynthetic process
GO:0044238	0.887	primary metabolic process
GO:0032502	0.577	developmental process
GO:0032501	0.577	multicellular organismal process
GO:0048856	0.394	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.999	cytosol
GO:0016020	0.706	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22048	1.000	7,8-dihydroneopterin 3'-triphosphate = 6-pyruvoyl-5,6,7,8-tetrahydropterin + H(+) + triphosphate
EC:4.2.3.12	1.000	6-pyruvoyltetrahydropterin synthase.

[back to server]