StarFunc result for job id Q03405

User Input

>input (335 residues)
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03405	1.000	1.000	2.324E-62	335	1.000	1.000	Q03405.pdb.gz	UPAR_HUMAN Urokinase plasminogen activator surface receptor OS=Homo sapiens OX=9606 GN=PLAUR PE=1 SV=1
2	PDB:3bt1U	0.798	0.976	5.082E-46	273	0.815	1.000	3bt1U.pdb.gz
3	AFDB:Q05588	0.845	0.857	2.925E-44	330	0.609	0.618	Q05588.pdb.gz	UPAR_BOVIN Urokinase plasminogen activator surface receptor OS=Bos taurus OX=9913 GN=PLAUR PE=2 SV=1
4	AFDB:P35456	0.811	0.830	3.695E-42	327	0.612	0.627	P35456.pdb.gz	UPAR_MOUSE Urokinase plasminogen activator surface receptor OS=Mus musculus OX=10090 GN=Plaur PE=1 SV=1
5	AFDB:P49616	0.815	0.832	9.427E-42	328	0.594	0.607	P49616.pdb.gz	UPAR_RAT Urokinase plasminogen activator surface receptor OS=Rattus norvegicus OX=10116 GN=Plaur PE=2 SV=2
6	PDB:3laqV	0.713	0.906	2.540E-29	260	0.496	0.638	3laqV.pdb.gz
7	AFDB:Q8N6Q3	0.216	0.170	1.382E-7	437	0.182	0.140	Q8N6Q3.pdb.gz	CD177_HUMAN CD177 antigen OS=Homo sapiens OX=9606 GN=CD177 PE=1 SV=2
8	AFDB:O95274	0.248	0.241	2.579E-7	346	0.173	0.168	O95274.pdb.gz	LYPD3_HUMAN Ly6/PLAUR domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LYPD3 PE=1 SV=2
9	AFDB:O55162	0.253	0.242	6.932E-7	352	0.167	0.159	O55162.pdb.gz	LYPD3_RAT Ly6/PLAUR domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Lypd3 PE=1 SV=1
10	AFDB:Q6UWN5	0.227	0.292	9.472E-7	251	0.134	0.179	Q6UWN5.pdb.gz	LYPD5_HUMAN Ly6/PLAUR domain-containing protein 5 OS=Homo sapiens OX=9606 GN=LYPD5 PE=1 SV=2
11	AFDB:Q6YI28	0.307	0.425	1.166E-6	220	0.140	0.214	Q6YI28.pdb.gz	Q6YI28_MOUSE EP1 OS=Mus musculus OX=10090 GN=Lypd8l PE=1 SV=1
12	AFDB:Q9VJ24	0.173	0.112	1.151E-5	561	0.179	0.107	Q9VJ24.pdb.gz	Q9VJ24_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15170 PE=4 SV=1
13	PDB:2n99A	0.192	0.729	2.838E-2	76	0.048	0.211	2n99A.pdb.gz
14	PDB:4zqyA	0.158	0.680	7.626E-2	65	0.051	0.262	4zqyA.pdb.gz
15	PDB:6wjcC	0.139	0.607	8.914E-2	69	0.045	0.217	6wjcC.pdb.gz	Structure and selectivity engineering of the M1muscarinic receptor toxin complex.
16	PDB:6zzeA	0.162	0.535	9.892E-2	82	0.063	0.256	6zzeA.pdb.gz
17	PDB:1hzhH	0.078	0.064	1.580E-1	457	0.093	0.068	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
18	PDB:3vtsA	0.146	0.691	1.664E-1	61	0.057	0.311	3vtsA.pdb.gz
19	PDB:6rc7A	0.143	0.640	4.246E-1	60	0.039	0.217	6rc7A.pdb.gz
20	PDB:1igaA	0.095	0.075	4.712E-1	475	0.101	0.072	1igaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03405	0.0	688	335	1.000	1.000	UPAR_HUMAN Urokinase plasminogen activator surface receptor OS=Homo sapiens OX=9606 GN=PLAUR PE=1 SV=1
2	Q05588	1.26e-144	413	330	0.585	0.594	UPAR_BOVIN Urokinase plasminogen activator surface receptor OS=Bos taurus OX=9913 GN=PLAUR PE=2 SV=1
3	P35456	3.49e-131	379	327	0.585	0.599	UPAR_MOUSE Urokinase plasminogen activator surface receptor OS=Mus musculus OX=10090 GN=Plaur PE=1 SV=1
4	P49616	3.09e-125	363	328	0.576	0.588	UPAR_RAT Urokinase plasminogen activator surface receptor OS=Rattus norvegicus OX=10116 GN=Plaur PE=2 SV=2
5	Q9TVA9	1.09e-86	261	204	0.370	0.608	Q9TVA9_BOVIN Urokinase plasminogen activator receptor (Fragment) OS=Bos taurus OX=9913 GN=uPaR PE=2 SV=1
6	O95274	1.58e-04	45.4	346	0.164	0.159	LYPD3_HUMAN Ly6/PLAUR domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LYPD3 PE=1 SV=2
7	O55162	0.002	42.0	352	0.170	0.162	LYPD3_RAT Ly6/PLAUR domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Lypd3 PE=1 SV=1
8	Q6YI28	0.004	40.4	220	0.137	0.209	Q6YI28_MOUSE EP1 OS=Mus musculus OX=10090 GN=Lypd8l PE=1 SV=1
9	Q8VE86	0.016	38.5	220	0.125	0.191	Q8VE86_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Lypd8l PE=2 SV=1
10	E7F2M5	0.17	34.3	118	0.101	0.288	E7F2M5_DANRE CD59 molecule (CD59 blood group) OS=Danio rerio OX=7955 GN=fj38b04 PE=1 SV=1
11	Q8N2G4	2.2	31.6	141	0.093	0.220	LYPD1_HUMAN Ly6/PLAUR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LYPD1 PE=1 SV=2
12	D4AE25	2.5	32.0	290	0.063	0.072	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
13	Q01151	2.5	32.0	205	0.081	0.132	CD83_HUMAN CD83 antigen OS=Homo sapiens OX=9606 GN=CD83 PE=1 SV=1
14	Q5NC41	4.4	31.2	235	0.140	0.200	Q5NC41_MOUSE RIKEN cDNA 1810065E05 gene OS=Mus musculus OX=10090 GN=1810065E05Rik PE=1 SV=1
15	Q8BLC3	5.1	30.4	141	0.075	0.177	LYPD1_MOUSE Ly6/PLAUR domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lypd1 PE=1 SV=1
16	Q9D8K1	5.9	30.8	235	0.087	0.123	Q9D8K1_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=1810065E05Rik PE=2 SV=1
17	Q8R0G1	7.7	30.4	235	0.081	0.115	Q8R0G1_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=1810065E05Rik PE=2 SV=1
18	Q57XV6	8.6	30.8	948	0.060	0.021	Q57XV6_TRYB2 Ribonuclease III OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.690 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00021 UPAR_LY6	6.3e-22	89.4	u-PAR/Ly-6 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339328

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223095	0.999	Plasminogen activator inhibitor 1
2	9606.ENSP00000226218	0.999	Vitronectin
3	9606.ENSP00000308938	0.999	Plasminogen
4	9606.ENSP00000361850	0.999	Urokinase-type plasminogen activator
5	9606.ENSP00000243077	0.998	Prolow-density lipoprotein receptor-related protein 1
6	9606.ENSP00000275493	0.998	Epidermal growth factor receptor
7	9606.ENSP00000441691	0.998	Integrin alpha-M
8	9606.ENSP00000468897	0.989	N-formyl peptide receptor 2
9	9606.ENSP00000379350	0.986	Integrin beta-1
10	9606.ENSP00000415786	0.986	Glia-derived nexin
11	9606.ENSP00000346839	0.984	Fibronectin type III domain containing
12	9606.ENSP00000471493	0.984	fMet-Leu-Phe receptor
13	9606.ENSP00000318195	0.983	Nucleolin
14	9606.ENSP00000349437	0.983	Cation-independent mannose-6-phosphate receptor
15	9606.ENSP00000401645	0.968	Plasminogen activator inhibitor 2
16	9606.ENSP00000362680	0.964	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000261023	0.962	Integrin alpha-V
18	9606.ENSP00000452786	0.961	Integrin beta-3
19	9606.ENSP00000362095	0.958	Sushi repeat-containing protein SRPX2
20	9606.ENSP00000222390	0.949	Hepatocyte growth factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0019899	1.000	enzyme binding
GO:0005102	0.988	signaling receptor binding
GO:0019904	0.758	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050896	0.991	response to stimulus
GO:0009987	0.990	cellular process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0080090	0.989	regulation of primary metabolic process
GO:0048522	0.989	positive regulation of cellular process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0051246	0.982	regulation of protein metabolic process
GO:0050790	0.977	regulation of catalytic activity
GO:0048519	0.975	negative regulation of biological process
GO:0051128	0.974	regulation of cellular component organization
GO:0032501	0.971	multicellular organismal process
GO:0051172	0.965	negative regulation of nitrogen compound metabolic process
GO:0048523	0.964	negative regulation of cellular process
GO:0010605	0.964	negative regulation of macromolecule metabolic process
GO:0048583	0.962	regulation of response to stimulus
GO:0051716	0.955	cellular response to stimulus
GO:0043067	0.946	regulation of programmed cell death
GO:0042981	0.944	regulation of apoptotic process
GO:0048584	0.943	positive regulation of response to stimulus
GO:0009966	0.936	regulation of signal transduction
GO:0043066	0.931	negative regulation of apoptotic process
GO:0051248	0.908	negative regulation of protein metabolic process
GO:0006950	0.906	response to stress
GO:0051336	0.906	regulation of hydrolase activity
GO:0009967	0.906	positive regulation of signal transduction
GO:0007165	0.905	signal transduction
GO:1902531	0.900	regulation of intracellular signal transduction
GO:0010604	0.897	positive regulation of macromolecule metabolic process
GO:0051173	0.891	positive regulation of nitrogen compound metabolic process
GO:0031325	0.890	positive regulation of cellular metabolic process
GO:0030162	0.883	regulation of proteolysis
GO:0042221	0.878	response to chemical
GO:0033043	0.866	regulation of organelle organization
GO:0044092	0.859	negative regulation of molecular function
GO:0045861	0.855	negative regulation of proteolysis
GO:0065008	0.827	regulation of biological quality
GO:0052548	0.819	regulation of endopeptidase activity
GO:0010466	0.819	negative regulation of peptidase activity
GO:0048585	0.816	negative regulation of response to stimulus
GO:0010951	0.801	negative regulation of endopeptidase activity
GO:0010821	0.789	regulation of mitochondrion organization
GO:0030155	0.777	regulation of cell adhesion
GO:0051247	0.761	positive regulation of protein metabolic process
GO:1901184	0.745	regulation of ERBB signaling pathway
GO:0009605	0.743	response to external stimulus
GO:2000116	0.739	regulation of cysteine-type endopeptidase activity
GO:0051174	0.726	regulation of phosphorus metabolic process
GO:0019220	0.719	regulation of phosphate metabolic process
GO:0044093	0.706	positive regulation of molecular function
GO:0042058	0.662	regulation of epidermal growth factor receptor signaling pathway
GO:0042325	0.654	regulation of phosphorylation
GO:2000117	0.601	negative regulation of cysteine-type endopeptidase activity
GO:0032502	0.580	developmental process
GO:0048856	0.574	anatomical structure development
GO:0090199	0.553	regulation of release of cytochrome c from mitochondria
GO:0050878	0.538	regulation of body fluid levels
GO:0009611	0.500	response to wounding
GO:0031399	0.499	regulation of protein modification process
GO:2001233	0.496	regulation of apoptotic signaling pathway
GO:0007599	0.491	hemostasis
GO:0050817	0.481	coagulation
GO:0001932	0.475	regulation of protein phosphorylation
GO:0042327	0.464	positive regulation of phosphorylation
GO:0001934	0.448	positive regulation of protein phosphorylation
GO:0009968	0.433	negative regulation of signal transduction
GO:0051130	0.421	positive regulation of cellular component organization
GO:0007275	0.411	multicellular organism development
GO:0042060	0.410	wound healing
GO:0045785	0.396	positive regulation of cell adhesion
GO:0022407	0.393	regulation of cell-cell adhesion
GO:0051098	0.390	regulation of binding
GO:0043281	0.376	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0007596	0.374	blood coagulation
GO:2001234	0.373	negative regulation of apoptotic signaling pathway
GO:0010638	0.365	positive regulation of organelle organization
GO:0051101	0.348	regulation of DNA binding
GO:0022409	0.336	positive regulation of cell-cell adhesion
GO:0043154	0.330	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0042330	0.319	taxis
GO:0045742	0.310	positive regulation of epidermal growth factor receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0012505	0.966	endomembrane system
GO:0043231	0.934	intracellular membrane-bounded organelle
GO:0031982	0.927	vesicle
GO:0005737	0.916	cytoplasm
GO:1902494	0.758	catalytic complex
GO:0043233	0.633	organelle lumen
GO:0070013	0.623	intracellular organelle lumen
GO:1905368	0.562	peptidase complex
GO:0005576	0.531	extracellular region
GO:0031090	0.522	organelle membrane
GO:0005783	0.517	endoplasmic reticulum
GO:1905369	0.488	endopeptidase complex
GO:0005615	0.470	extracellular space
GO:0009986	0.458	cell surface
GO:1905370	0.390	serine-type endopeptidase complex
GO:0030141	0.350	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]