StarFunc result for job id Q03431

User Input

>input (593 residues)
MGTARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPA
SIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPL
GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETRE
REVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVK
DAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWIL
VEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK
WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVH
YIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLA
LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKP
GTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQEEWETVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03431	1.000	1.000	1.077E-79	593	1.000	1.000	Q03431.pdb.gz	PTH1R_HUMAN Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Homo sapiens OX=9606 GN=PTH1R PE=1 SV=1
2	AFDB:Q9PVD3	0.716	0.789	1.218E-50	536	0.614	0.679	Q9PVD3.pdb.gz	Q9PVD3_DANRE Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Danio rerio OX=7955 GN=pth1ra PE=2 SV=1
3	AFDB:F1QGZ1	0.695	0.758	5.961E-45	542	0.511	0.559	F1QGZ1.pdb.gz
4	AFDB:B0S4Y6	0.690	0.711	3.333E-42	575	0.467	0.482	B0S4Y6.pdb.gz
5	AFDB:Q91V95	0.691	0.749	9.782E-42	546	0.440	0.478	Q91V95.pdb.gz	PTH2R_MOUSE Parathyroid hormone 2 receptor OS=Mus musculus OX=10090 GN=Pth2r PE=1 SV=1
6	AFDB:F1RCQ6	0.594	0.685	5.183E-29	509	0.283	0.330	F1RCQ6.pdb.gz	F1RCQ6_DANRE Glucagon receptor b OS=Danio rerio OX=7955 GN=gcgrb PE=4 SV=2
7	AFDB:P47872	0.535	0.698	3.732E-28	440	0.300	0.405	P47872.pdb.gz	SCTR_HUMAN Secretin receptor OS=Homo sapiens OX=9606 GN=SCTR PE=1 SV=2
8	AFDB:P23811	0.559	0.719	1.002E-27	449	0.307	0.405	P23811.pdb.gz	SCTR_RAT Secretin receptor OS=Rattus norvegicus OX=10116 GN=Sctr PE=1 SV=1
9	AFDB:P30082	0.570	0.684	1.047E-27	485	0.266	0.326	P30082.pdb.gz	GLR_RAT Glucagon receptor OS=Rattus norvegicus OX=10116 GN=Gcgr PE=1 SV=2
10	AFDB:P30083	0.567	0.715	1.311E-27	459	0.297	0.383	P30083.pdb.gz	VIPR1_RAT Vasoactive intestinal polypeptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Vipr1 PE=2 SV=1
11	PDB:7finR	0.566	0.861	8.479E-23	380	0.258	0.403	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
12	PDB:7lciR	0.495	0.710	8.479E-23	393	0.250	0.377	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
13	PDB:7vqxR	0.475	0.751	2.380E-22	361	0.245	0.402	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
14	PDB:7tynR	0.438	0.678	6.295E-21	373	0.214	0.340	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
15	PDB:7d3sR	0.431	0.947	3.622E-20	266	0.236	0.526	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
16	PDB:7durR	0.451	0.691	1.112E-19	371	0.250	0.399	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
17	PDB:6wpwR	0.510	0.737	1.455E-19	398	0.224	0.334	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
18	PDB:6vn7R	0.426	0.945	1.372E-18	263	0.223	0.502	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
19	PDB:5xezB	0.398	0.467	1.065E-16	499	0.226	0.269	5xezB.pdb.gz	Structure of the full-length glucagon class B G-protein-coupled receptor.
20	PDB:7cz5R	0.414	0.891	1.165E-16	269	0.184	0.405	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P25961	0.0	1081	591	0.904	0.907	PTH1R_RAT Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Rattus norvegicus OX=10116 GN=Pth1r PE=1 SV=1
2	P41593	0.0	1058	591	0.890	0.893	PTH1R_MOUSE Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Mus musculus OX=10090 GN=Pth1r PE=1 SV=2
3	Q03431	0.0	1232	593	1.000	1.000	PTH1R_HUMAN Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Homo sapiens OX=9606 GN=PTH1R PE=1 SV=1
4	Q9PVD2	0.0	583	542	0.506	0.554	Q9PVD2_DANRE Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Danio rerio OX=7955 GN=pth1rb PE=2 SV=1
5	Q9PVD3	0.0	751	536	0.627	0.694	Q9PVD3_DANRE Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Danio rerio OX=7955 GN=pth1ra PE=2 SV=1
6	Q9PWB7	7.28e-173	504	575	0.445	0.459	Q9PWB7_DANRE Parathyroid hormone 2 receptor a OS=Danio rerio OX=7955 GN=zgc:123155 PE=2 SV=1
7	P49190	3.73e-169	494	550	0.432	0.465	PTH2R_HUMAN Parathyroid hormone 2 receptor OS=Homo sapiens OX=9606 GN=PTH2R PE=1 SV=1
8	P70555	3.01e-163	479	546	0.437	0.474	PTH2R_RAT Parathyroid hormone 2 receptor OS=Rattus norvegicus OX=10116 GN=Pth2r PE=2 SV=1
9	Q91V95	7.10e-163	478	546	0.433	0.471	PTH2R_MOUSE Parathyroid hormone 2 receptor OS=Mus musculus OX=10090 GN=Pth2r PE=1 SV=1
10	P47872	1.54e-103	322	440	0.300	0.405	SCTR_HUMAN Secretin receptor OS=Homo sapiens OX=9606 GN=SCTR PE=1 SV=2
11	P23811	1.77e-103	322	449	0.288	0.381	SCTR_RAT Secretin receptor OS=Rattus norvegicus OX=10116 GN=Sctr PE=1 SV=1
12	P30083	9.58e-102	318	459	0.270	0.349	VIPR1_RAT Vasoactive intestinal polypeptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Vipr1 PE=2 SV=1
13	F1R383	1.22e-99	312	446	0.263	0.350	F1R383_DANRE Vasoactive intestinal peptide receptor 1b OS=Danio rerio OX=7955 GN=vipr1 PE=3 SV=1
14	Q5FWI2	5.58e-99	310	447	0.295	0.391	SCTR_MOUSE Secretin receptor OS=Mus musculus OX=10090 GN=Sctr PE=1 SV=1
15	Q5C8U9	8.76e-98	306	422	0.260	0.365	Q5C8U9_DANRE VPAC1 receptor OS=Danio rerio OX=7955 GN=vipr1 PE=2 SV=1
16	P32241	1.43e-95	301	457	0.277	0.359	VIPR1_HUMAN Vasoactive intestinal polypeptide receptor 1 OS=Homo sapiens OX=9606 GN=VIPR1 PE=1 SV=1
17	Q32PR7	2.31e-95	297	339	0.223	0.389	Q32PR7_DANRE Parathyroid hormone 2 receptor OS=Danio rerio OX=7955 GN=pth2r PE=2 SV=1
18	P35000	7.79e-91	289	437	0.287	0.389	VIPR2_RAT Vasoactive intestinal polypeptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Vipr2 PE=2 SV=1
19	Q5C8V0	1.33e-87	281	451	0.258	0.339	Q5C8V0_DANRE PAC1 receptor short isoform OS=Danio rerio OX=7955 GN=adcyap1r1 PE=2 SV=1
20	A0A090N8F8	8.22e-85	274	468	0.277	0.350	A0A090N8F8_HUMAN Adenylate cyclase activating polypeptide 1 (Pituitary) receptor type I OS=Homo sapiens OX=9606 GN=ADCYAP1R1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	3.1e-89	310.1	7 transmembrane receptor (Secretin family)
2	PF02793 HRM	1.4e-15	68.6	Hormone receptor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321999

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282091	0.999	Parathyroid hormone
2	9606.ENSP00000441765	0.999	Parathyroid hormone-related protein
3	9606.ENSP00000261349	0.988	Low-density lipoprotein receptor-related protein 6
4	9606.ENSP00000262613	0.988	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
5	9606.ENSP00000403701	0.971	Beta-arrestin-2
6	9606.ENSP00000408005	0.960	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
7	9606.ENSP00000286548	0.959	Guanine nucleotide-binding protein G(q) subunit alpha
8	9606.ENSP00000360141	0.958	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
9	9606.ENSP00000270631	0.933	Tuberoinfundibular peptide of 39 residues
10	9606.ENSP00000409581	0.921	Beta-arrestin-1
11	9606.ENSP00000386444	0.912	S-arrestin
12	9606.ENSP00000368169	0.878	Segment polarity protein dishevelled homolog DVL-1
13	9606.ENSP00000343027	0.875	Guanine nucleotide-binding protein G(i) subunit alpha-1
14	9606.ENSP00000481878	0.860	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
15	9606.ENSP00000078429	0.857	Guanine nucleotide-binding protein subunit alpha-11
16	9606.ENSP00000275364	0.837	Guanine nucleotide-binding protein subunit alpha-12
17	9606.ENSP00000400717	0.829	Guanine nucleotide-binding protein subunit alpha-13
18	9606.ENSP00000312999	0.828	Guanine nucleotide-binding protein G(i) subunit alpha-2
19	9606.ENSP00000334448	0.828	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
20	9606.ENSP00000358867	0.826	Guanine nucleotide-binding protein G(k) subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0017046	0.995	peptide hormone binding
GO:0005515	0.967	protein binding
GO:0004991	0.687	parathyroid hormone receptor activity
GO:0042802	0.460	identical protein binding
GO:0043621	0.312	protein self-association

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051716	0.996	cellular response to stimulus
GO:0023052	0.995	signaling
GO:0007154	0.995	cell communication
GO:0007165	0.993	signal transduction
GO:0007186	0.970	G protein-coupled receptor signaling pathway
GO:0007188	0.957	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	0.872	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0032501	0.658	multicellular organismal process
GO:0032502	0.649	developmental process
GO:0048856	0.516	anatomical structure development
GO:0007275	0.483	multicellular organism development
GO:0048518	0.422	positive regulation of biological process
GO:0048731	0.410	system development
GO:0048522	0.379	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043226	0.981	organelle
GO:0005622	0.981	intracellular anatomical structure
GO:0005634	0.972	nucleus
GO:0005737	0.946	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]