StarFunc result for job id Q03468

User Input

>input (1493 residues)
MPNEGIPHSSQTQEQDCLQSQPVSNNEEMAIKQESGGDGEVEEYLSFRSVGDGLSTSAVG
CASAAPRRGPALLHIDRHQIQAVEPSAQALELQGLGVDVYDQDVLEQGVLQQVDNAIHEA
SRASQLVDVEKEYRSVLDDLTSCTTSLRQINKIIEQLSPQAATSRDINRKLDSVKRQKYN
KEQQLKKITAKQKHLQAILGGAEVKIELDHASLEEDAEPGPSSLGSMLMPVQETAWEELI
RTGQMTPFGTQIPQKQEKKPRKIMLNEASGFEKYLADQAKLSFERKKQGCNKRAARKAPA
PVTPPAPVQNKNKPNKKARVLSKKEERLKKHIKKLQKRALQFQGKVGLPKARRPWESDMR
PEAEGDSEGEESEYFPTEEEEEEEDDEVEGAEADLSGDGTDYELKPLPKGGKRQKKVPVQ
EIDDDFFPSSGEEAEAASVGEGGGGGRKVGRYRDDGDEDYYKQRLRRWNKLRLQDKEKRL
KLEDDSEESDAEFDEGFKVPGFLFKKLFKYQQTGVRWLWELHCQQAGGILGDEMGLGKTI
QIIAFLAGLSYSKIRTRGSNYRFEGLGPTVIVCPTTVMHQWVKEFHTWWPPFRVAILHET
GSYTHKKEKLIRDVAHCHGILITSYSYIRLMQDDISRYDWHYVILDEGHKIRNPNAAVTL
ACKQFRTPHRIILSGSPMQNNLRELWSLFDFIFPGKLGTLPVFMEQFSVPITMGGYSNAS
PVQVKTAYKCACVLRDTINPYLLRRMKSDVKMSLSLPDKNEQVLFCRLTDEQHKVYQNFV
DSKEVYRILNGEMQIFSGLIALRKICNHPDLFSGGPKNLKGLPDDELEEDQFGYWKRSGK
MIVVESLLKIWHKQGQRVLLFSQSRQMLDILEVFLRAQKYTYLKMDGTTTIASRQPLITR
YNEDTSIFVFLLTTRVGGLGVNLTGANRVVIYDPDWNPSTDTQARERAWRIGQKKQVTVY
RLLTAGTIEEKIYHRQIFKQFLTNRVLKDPKQRRFFKSNDLYELFTLTSPDASQSTETSA
IFAGTGSDVQTPKCHLKRRIQPAFGADHDVPKRKKFPASNISVNDATSSEEKSEAKGAEV
NAVTSNRSDPLKDDPHMSSNVTSNDRLGEETNAVSGPEELSVISGNGECSNSSGTGKTSM
PSGDESIDEKLGLSYKRERPSQAQTEAFWENKQMENNFYKHKSKTKHHSVAEEETLEKHL
RPKQKPKNSKHCRDAKFEGTRIPHLVKKRRYQKQDSENKSEAKEQSNDDYVLEKLFKKSV
GVHSVMKHDAIMDGASPDYVLVEAEANRVAQDALKALRLSRQRCLGAVSGVPTWTGHRGI
SGAPAGKKSRFGKKRNSNFSVQHPSSTSPTEKCQDGIMKKEGKDNVPEHFSGRAEDADSS
SGPLASSSLLAKMRARNHLILPERLESESGHLQEASALLPTTEHDDLLVEMRNFIAFQAH
TDGQASTREILQEFESKLSASQSCVFRELLRNLCTFHRTSGGEGIWKLKPEYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8VPZ5	0.566	0.570	0.000	1481	0.790	0.797	F8VPZ5.pdb.gz	ERCC6_MOUSE DNA excision repair protein ERCC-6 OS=Mus musculus OX=10090 GN=Ercc6 PE=1 SV=1
2	AFDB:Q03468	1.000	1.000	0.000	1493	1.000	1.000	Q03468.pdb.gz	ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
3	PDB:7oo3b	0.341	0.938	3.300E-80	534	0.346	0.968	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
4	AFDB:P40352	0.365	0.499	7.703E-67	1085	0.238	0.328	P40352.pdb.gz	RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD26 PE=1 SV=1
5	AFDB:P0DP91	0.103	0.142	3.209E-51	1061	0.311	0.438	P0DP91.pdb.gz	ERPG3_HUMAN Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
6	AFDB:Q2NKX8	0.332	0.395	2.328E-48	1250	0.170	0.203	Q2NKX8.pdb.gz	ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1
7	AFDB:P32863	0.325	0.533	1.684E-44	898	0.137	0.228	P32863.pdb.gz	RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD54 PE=1 SV=1
8	AFDB:P70270	0.312	0.601	3.146E-43	747	0.135	0.269	P70270.pdb.gz	RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus OX=10090 GN=Rad54l PE=1 SV=2
9	AFDB:Q9Y620	0.316	0.508	1.360E-42	910	0.147	0.241	Q9Y620.pdb.gz	RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens OX=9606 GN=RAD54B PE=1 SV=1
10	AFDB:F1Q8K0	0.324	0.625	7.632E-42	738	0.132	0.267	F1Q8K0.pdb.gz	RAD54_DANRE DNA repair and recombination protein RAD54-like OS=Danio rerio OX=7955 GN=rad54l PE=1 SV=1
11	PDB:5vvrM	0.279	0.773	1.054E-41	503	0.193	0.573	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
12	AFDB:F1LYB7	0.306	0.496	1.587E-41	888	0.143	0.240	F1LYB7.pdb.gz	F1LYB7_RAT RAD54 homolog B OS=Rattus norvegicus OX=10116 GN=Rad54b PE=4 SV=2
13	PDB:6jylK	0.284	0.796	3.614E-32	504	0.119	0.353	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
14	PDB:6tdaS	0.275	0.508	3.799E-31	783	0.114	0.217	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
15	PDB:6g0lM	0.260	0.442	5.450E-29	855	0.107	0.187	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
16	PDB:6gejM	0.266	0.557	6.051E-29	688	0.120	0.260	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:6g0lW	0.268	0.446	1.393E-27	878	0.107	0.182	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
18	PDB:6uxwA	0.274	0.513	1.252E-26	778	0.109	0.208	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
19	PDB:7epuB	0.189	0.328	5.701E-26	748	0.104	0.209	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
20	PDB:6kw3Y	0.280	0.725	3.743E-25	548	0.113	0.308	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTU1	0.0	2261	1474	0.782	0.792	A0A0G2JTU1_RAT ERCC excision repair 6, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Ercc6 PE=1 SV=1
2	D3ZS47	0.0	1863	1325	0.650	0.733	D3ZS47_RAT ERCC excision repair 6, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Ercc6 PE=1 SV=1
3	F8VPZ5	0.0	2324	1481	0.790	0.797	ERCC6_MOUSE DNA excision repair protein ERCC-6 OS=Mus musculus OX=10090 GN=Ercc6 PE=1 SV=1
4	P0DP91	0.0	830	1061	0.311	0.438	ERPG3_HUMAN Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
5	P40352	0.0	639	1085	0.212	0.291	RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD26 PE=1 SV=1
6	Q03468	0.0	3109	1493	1.000	1.000	ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
7	Q9UR24	0.0	659	973	0.230	0.354	RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp26 PE=4 SV=1
8	Q9ZV43	0.0	632	1187	0.202	0.254	CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana OX=3702 GN=CHR8 PE=2 SV=1
9	Q57UN8	2.15e-139	460	1126	0.174	0.231	Q57UN8_TRYB2 DNA excision repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.540 PE=4 SV=1
10	Q93781	1.90e-111	378	957	0.140	0.218	Q93781_CAEEL CSB (Cockayne Syndrome B) homolog OS=Caenorhabditis elegans OX=6239 GN=csb-1 PE=1 SV=2
11	Q8W103	6.56e-106	366	1090	0.141	0.193	CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana OX=3702 GN=CHR24 PE=2 SV=1
12	A0A0P0WGX7	4.13e-104	358	987	0.136	0.206	ENL1_ORYSJ SNF2 domain-containing protein ENL1 OS=Oryza sativa subsp. japonica OX=39947 GN=ENL1 PE=2 SV=1
13	Q2NKX8	1.23e-101	357	1250	0.139	0.166	ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1
14	Q08773	2.22e-89	318	1120	0.127	0.169	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1
15	Q5A310	9.19e-89	315	1056	0.120	0.170	ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ISW2 PE=2 SV=1
16	O43065	2.33e-85	311	1953	0.131	0.100	BTAF1_SCHPO TATA-binding protein-associated factor mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mot1 PE=1 SV=4
17	Q5T890	3.78e-85	310	1561	0.129	0.124	ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens OX=9606 GN=ERCC6L2 PE=1 SV=2
18	A0A590UJ07	4.19e-85	310	1550	0.129	0.125	A0A590UJ07_HUMAN ERCC excision repair 6 like 2 OS=Homo sapiens OX=9606 GN=ERCC6L2 PE=1 SV=1
19	F4K128	2.19e-84	302	1064	0.120	0.168	CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana OX=3702 GN=CHR23 PE=2 SV=1
20	O60264	5.13e-84	301	1052	0.121	0.172	SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00271 Helicase_C	3.3e-15	67.7	Helicase conserved C-terminal domain
2	PF00176 SNF2-rel_dom	1.5e-78	275.5	SNF2-related domain
3	PF03439 Spt5-NGN	3.2e+02	12.6	Early transcription elongation factor of RNA pol II, NGN section

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348089

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265038	0.988	DNA excision repair protein ERCC-8
2	9606.ENSP00000480158	0.969	DNA-directed RNA polymerase II subunit RPB1
3	9606.ENSP00000347978	0.952	DNA repair protein complementing XP-G cells
4	9606.ENSP00000221859	0.931	DNA-directed RNA polymerase II subunit RPB9
5	9606.ENSP00000364270	0.922	DNA repair protein complementing XP-A cells
6	9606.ENSP00000370625	0.912	DNA-directed RNA polymerase II subunit RPB2
7	9606.ENSP00000310520	0.898	DNA repair endonuclease XPF
8	9606.ENSP00000374501	0.895	UV-stimulated scaffold protein A
9	9606.ENSP00000375809	0.885	TFIIH basal transcription factor complex helicase XPD subunit
10	9606.ENSP00000285398	0.870	TFIIH basal transcription factor complex helicase XPB subunit
11	9606.ENSP00000441543	0.861	Polyubiquitin-C
12	9606.ENSP00000343535	0.834	Ubiquitin carboxyl-terminal hydrolase 7
13	9606.ENSP00000285021	0.827	DNA repair protein complementing XP-C cells
14	9606.ENSP00000272317	0.819	Ubiquitin-40S ribosomal protein S27a
15	9606.ENSP00000304697	0.816	Polyubiquitin-B
16	9606.ENSP00000013807	0.815	DNA excision repair protein ERCC-1
17	9606.ENSP00000388107	0.808	Ubiquitin-60S ribosomal protein L40
18	9606.ENSP00000350708	0.805	UV excision repair protein RAD23 homolog B
19	9606.ENSP00000423550	0.802	Involved in repair of DNA damage following UV irradiation, acting either in the absence of ERCC6 or synergistically with ERCC6. Involved in the regulation of gene expression. In the absence of ERCC6, induces the expression of genes characteristic of interferon-like antiviral responses. This response is almost completely suppressed in the presence of ERCC6. In the presence of ERCC6, regulates the expression of genes involved in metabolism regulation, including IGFBP5 and IGFBP7. In vitro binds to PGBD3-related transposable elements, called MER85s
20	9606.ENSP00000269305	0.796	Cellular tumor antigen p53

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008094	1.000	ATP-dependent activity, acting on DNA
GO:0003677	1.000	DNA binding
GO:0003682	0.994	chromatin binding
GO:0140658	0.928	ATP-dependent chromatin remodeler activity
GO:0000166	0.879	nucleotide binding
GO:0097367	0.861	carbohydrate derivative binding
GO:0043167	0.860	ion binding
GO:0017076	0.854	purine nucleotide binding
GO:0030554	0.841	adenyl nucleotide binding
GO:0032555	0.838	purine ribonucleotide binding
GO:0043168	0.831	anion binding
GO:0035639	0.816	purine ribonucleoside triphosphate binding
GO:0032559	0.808	adenyl ribonucleotide binding
GO:0019899	0.764	enzyme binding
GO:0005524	0.752	ATP binding
GO:0140677	0.717	molecular function activator activity
GO:0030234	0.699	enzyme regulator activity
GO:0019887	0.692	protein kinase regulator activity
GO:0008047	0.688	enzyme activator activity
GO:0019209	0.682	kinase activator activity
GO:0044877	0.541	protein-containing complex binding
GO:0030296	0.529	protein tyrosine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.995	response to stimulus
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0051716	0.989	cellular response to stimulus
GO:0006807	0.986	nitrogen compound metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0044237	0.985	cellular metabolic process
GO:0043170	0.982	macromolecule metabolic process
GO:0006950	0.981	response to stress
GO:0033554	0.969	cellular response to stress
GO:0090304	0.966	nucleic acid metabolic process
GO:0006974	0.961	cellular response to DNA damage stimulus
GO:0044260	0.942	cellular macromolecule metabolic process
GO:0060255	0.934	regulation of macromolecule metabolic process
GO:0006259	0.932	DNA metabolic process
GO:0006281	0.917	DNA repair
GO:0080090	0.914	regulation of primary metabolic process
GO:0051171	0.912	regulation of nitrogen compound metabolic process
GO:0009411	0.904	response to UV
GO:0019219	0.885	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.750	regulation of gene expression
GO:0031326	0.685	regulation of cellular biosynthetic process
GO:0010556	0.683	regulation of macromolecule biosynthetic process
GO:0051252	0.681	regulation of RNA metabolic process
GO:2001141	0.664	regulation of RNA biosynthetic process
GO:0048518	0.599	positive regulation of biological process
GO:0006355	0.572	regulation of DNA-templated transcription
GO:0009893	0.564	positive regulation of metabolic process
GO:0048522	0.562	positive regulation of cellular process
GO:0051173	0.521	positive regulation of nitrogen compound metabolic process
GO:0016043	0.479	cellular component organization
GO:0010604	0.477	positive regulation of macromolecule metabolic process
GO:0045935	0.375	positive regulation of nucleobase-containing compound metabolic process
GO:0051052	0.374	regulation of DNA metabolic process
GO:0048519	0.339	negative regulation of biological process
GO:0048523	0.317	negative regulation of cellular process
GO:0006289	0.308	nucleotide-excision repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005694	0.997	chromosome
GO:0032991	0.994	protein-containing complex
GO:0000785	0.966	chromatin
GO:1902494	0.952	catalytic complex
GO:0140513	0.926	nuclear protein-containing complex
GO:0005730	0.687	nucleolus
GO:0090734	0.513	site of DNA damage
GO:1904949	0.506	ATPase complex
GO:0070603	0.490	SWI/SNF superfamily-type complex
GO:0008023	0.437	transcription elongation factor complex
GO:0110016	0.374	B-WICH complex
GO:0005737	0.353	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]