StarFunc result for job id Q03591

User Input

>input (330 residues)
MWLLVSVILISRISSVGGEATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRL
QNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPSGERVRYECRSPY
EMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNL
YQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVC
KRGYRLSSRSHTLRTTCWDGKLEYPTCAKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03591	1.000	1.000	9.374E-65	330	1.000	1.000	Q03591.pdb.gz	FHR1_HUMAN Complement factor H-related protein 1 OS=Homo sapiens OX=9606 GN=CFHR1 PE=1 SV=2
2	AFDB:P36980	0.405	0.493	1.932E-43	270	0.709	0.867	P36980.pdb.gz	FHR2_HUMAN Complement factor H-related protein 2 OS=Homo sapiens OX=9606 GN=CFHR2 PE=1 SV=1
3	AFDB:P08603	0.383	0.110	6.835E-40	1231	0.645	0.173	P08603.pdb.gz	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
4	AFDB:Q9BXR6	0.405	0.240	1.026E-39	569	0.639	0.371	Q9BXR6.pdb.gz	FHR5_HUMAN Complement factor H-related protein 5 OS=Homo sapiens OX=9606 GN=CFHR5 PE=1 SV=1
5	AFDB:Q5XJW6	0.391	0.207	2.510E-38	689	0.521	0.250	Q5XJW6.pdb.gz	Q5XJW6_RAT Cfh protein OS=Rattus norvegicus OX=10116 GN=Cfh PE=1 SV=1
6	AFDB:Q02985	0.360	0.360	6.427E-34	330	0.415	0.415	Q02985.pdb.gz	FHR3_HUMAN Complement factor H-related protein 3 OS=Homo sapiens OX=9606 GN=CFHR3 PE=1 SV=2
7	AFDB:Q8R0I8	0.370	0.242	8.394E-32	509	0.412	0.267	Q8R0I8.pdb.gz	Q8R0I8_MOUSE BC026782 protein OS=Mus musculus OX=10090 GN=Cfhr2 PE=2 SV=1
8	AFDB:P06909	0.388	0.112	1.325E-31	1234	0.452	0.121	P06909.pdb.gz	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
9	AFDB:E9Q8B5	0.477	0.197	2.838E-31	879	0.400	0.150	E9Q8B5.pdb.gz	E9Q8B5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
10	AFDB:Q92496	0.355	0.207	3.848E-31	578	0.391	0.223	Q92496.pdb.gz	FHR4_HUMAN Complement factor H-related protein 4 OS=Homo sapiens OX=9606 GN=CFHR4 PE=1 SV=3
11	PDB:1haqA	0.272	0.098	4.545E-27	1213	0.645	0.176	1haqA.pdb.gz
12	PDB:1c1zA	0.247	0.250	2.980E-18	326	0.239	0.242	1c1zA.pdb.gz
13	PDB:2gsxA	0.201	0.082	1.234E-17	951	0.245	0.085	2gsxA.pdb.gz
14	PDB:2q7zA	0.269	0.059	7.155E-16	1931	0.255	0.044	2q7zA.pdb.gz
15	PDB:8a7eC	0.195	0.062	1.010E-9	1524	0.224	0.049	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:2xwbF	0.248	0.136	1.646E-8	714	0.124	0.057	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
17	PDB:3t5oA	0.177	0.071	9.727E-8	871	0.130	0.049	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
18	PDB:4e0sB	0.204	0.094	1.023E-7	898	0.127	0.047	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
19	PDB:8a7dQ	0.173	0.205	2.971E-7	273	0.124	0.150	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
20	PDB:4a5wB	0.189	0.090	8.465E-6	871	0.127	0.048	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03591	0.0	685	330	1.000	1.000	FHR1_HUMAN Complement factor H-related protein 1 OS=Homo sapiens OX=9606 GN=CFHR1 PE=1 SV=2
2	P08603	2.14e-132	408	1231	0.648	0.174	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
3	P36980	7.71e-118	342	270	0.497	0.607	FHR2_HUMAN Complement factor H-related protein 2 OS=Homo sapiens OX=9606 GN=CFHR2 PE=1 SV=1
4	Q9BXR6	1.43e-102	314	569	0.515	0.299	FHR5_HUMAN Complement factor H-related protein 5 OS=Homo sapiens OX=9606 GN=CFHR5 PE=1 SV=1
5	Q5XJW6	5.27e-99	308	689	0.506	0.242	Q5XJW6_RAT Cfh protein OS=Rattus norvegicus OX=10116 GN=Cfh PE=1 SV=1
6	Q02985	5.91e-95	286	330	0.406	0.406	FHR3_HUMAN Complement factor H-related protein 3 OS=Homo sapiens OX=9606 GN=CFHR3 PE=1 SV=2
7	G3V9R2	1.26e-85	282	1235	0.464	0.124	G3V9R2_RAT Complement factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=4 SV=1
8	P06909	3.19e-79	264	1234	0.424	0.113	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
9	Q91YB6	3.25e-79	264	1236	0.448	0.120	Q91YB6_RAT Complement inhibitory factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=2 SV=1
10	Q61407	5.29e-78	247	452	0.415	0.303	Q61407_MOUSE Complement factor H-related protein (Fragment) OS=Mus musculus OX=10090 GN=Cfhr2 PE=2 SV=1
11	Q8R0I8	3.52e-77	246	509	0.415	0.269	Q8R0I8_MOUSE BC026782 protein OS=Mus musculus OX=10090 GN=Cfhr2 PE=2 SV=1
12	Q92496	9.79e-77	247	578	0.385	0.220	FHR4_HUMAN Complement factor H-related protein 4 OS=Homo sapiens OX=9606 GN=CFHR4 PE=1 SV=3
13	Q0KHD3	4.24e-69	233	879	0.400	0.150	Q0KHD3_MOUSE Complement factor H-related protein C OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
14	E9Q8B5	1.88e-68	231	879	0.397	0.149	E9Q8B5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
15	B2RUG5	2.12e-67	228	878	0.394	0.148	B2RUG5_MOUSE EG214403 protein OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
16	Q61408	3.19e-66	224	808	0.364	0.149	Q61408_MOUSE Complement factor H-related protein OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
17	E9PUM5	5.55e-66	223	808	0.367	0.150	E9PUM5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
18	Q4LDF6	1.05e-61	201	332	0.388	0.386	Q4LDF6_MOUSE Complement factor H-related 2 OS=Mus musculus OX=10090 GN=Cfhr2 PE=1 SV=1
19	Q0KHD2	1.25e-60	209	820	0.312	0.126	Q0KHD2_MOUSE Complement factor H-related protein C OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
20	A0A668KLU9	3.45e-60	197	332	0.379	0.377	A0A668KLU9_MOUSE Complement factor H-related 2 OS=Mus musculus OX=10090 GN=Cfhr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09227 Bubble	2.9e+02	13.2	Bubble protein
2	PF12662 cEGF	6.5e+02	11.7	Complement Clr-like EGF-like
3	PF05730 CFEM	2.6e+02	13.1	CFEM domain
4	PF00084 Sushi	5.8e-38	140.5	Sushi repeat (SCR repeat)
5	PF09014 Sushi_2	1.4e+02	13.8	Beta-2-glycoprotein-1 fifth domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314299

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245907	0.999	Complement C3
2	9606.ENSP00000356395	0.963	Complement factor H-related protein 3
3	9606.ENSP00000356399	0.954	Complement factor H
4	9606.ENSP00000356385	0.940	Complement factor H-related 2
5	9606.ENSP00000337452	0.937	Magnesium transporter NIPA1
6	9606.ENSP00000337618	0.937	Magnesium transporter NIPA2
7	9606.ENSP00000480316	0.937	Gamma-tubulin complex component 5
8	9606.ENSP00000295927	0.908	Pentraxin-related protein PTX3
9	9606.ENSP00000260453	0.875	Meiosis-specific nuclear structural protein 1
10	9606.ENSP00000481038	0.835	Cytoplasmic FMR1-interacting protein 1
11	9606.ENSP00000416561	0.821	Complement factor B
12	9606.ENSP00000356391	0.818	Complement factor H-related protein 2
13	9606.ENSP00000256785	0.771	Complement factor H-related protein 5
14	9606.ENSP00000255030	0.738	C-reactive protein
15	9606.ENSP00000247153	0.719	Properdin
16	9606.ENSP00000284061	0.710	Diacylglycerol kinase epsilon
17	9606.ENSP00000378130	0.708	Complement factor I
18	9606.ENSP00000396688	0.708	Complement C4-A
19	9606.ENSP00000415941	0.706	Complement C4-B
20	9606.ENSP00000410815	0.681	Complement factor B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0001848	0.304	complement binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050896	0.996	response to stimulus
GO:0006956	0.985	complement activation
GO:0006950	0.962	response to stress
GO:0009605	0.955	response to external stimulus
GO:0044419	0.953	biological process involved in interspecies interaction between organisms
GO:0009607	0.949	response to biotic stimulus
GO:0051707	0.942	response to other organism
GO:0006952	0.931	defense response
GO:0044092	0.927	negative regulation of molecular function
GO:0044403	0.926	biological process involved in symbiotic interaction
GO:0051702	0.923	biological process involved in interaction with symbiont
GO:0051100	0.915	negative regulation of binding
GO:0043393	0.914	regulation of protein binding
GO:0051873	0.900	killing by host of symbiont cells
GO:0032091	0.895	negative regulation of protein binding
GO:0009987	0.492	cellular process
GO:0050794	0.473	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0032991	0.992	protein-containing complex
GO:0031982	0.889	vesicle
GO:0072562	0.883	blood microparticle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]