StarFunc result for job id Q03701

User Input

>input (1054 residues)
MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGGTKQDYLMLAT
LDENEEVIDGGKKGAIDDLQQGELEAFIQNLNLAKYTKASLVEEDEPAEKENSSKKEVKI
PKINNKNTAESQRTSVNKVKNKNRPEPHSDENGSTTPKVKKDKQNIFEFFERQTLLLRPG
GKWYDLEYSNEYSLKPQPQDVVSKYKTLAQKLYQHEINLFKSKTNSQKGASSTWMKAIVS
SGTLGDRMAAMILLIQDDAVHTLQFVETLVNLVKKKGSKQQCLMALDTFKELLITDLLPD
NRKLRIFSQRPFDKLEQLSSGNKDSRDRRLILWYFEHQLKHLVAEFVQVLETLSHDTLVT
TKTRALTVAHELLCNKPEEEKALLVQVVNKLGDPQNRIATKASHLLETLLCKHPNMKGVV
SGEVERLLFRSNISSKAQYYAICFLNQMALSHEESELANKLITVYFCFFRTCVKKKDVES
KMLSALLTGVNRAYPYSQTGDDKVREQIDTLFKVLHIVNFNTSVQALMLLFQVMNSQQTI
SDRYYTALYRKMLDPGLMTCSKQAMFLNLVYKSLKADIVLRRVKAFVKRLLQVTCQQMPP
FICGALYLVSEILKAKPGLRSQLDDHPESDDEENFIDANDDEDMEKFTDADKETEIVKKL
ETEETVPETDVETKKPEVASWVHFDNLKGGKQLNKYDPFSRNPLFCGAENTSLWELKKLS
VHFHPSVALFAKTILQGNYIQYSGDPLQDFTLMRFLDRFVYRNPKPHKGKENTDSVVMQP
KRKHFIKDIRHLPVNSKEFLAKEESQIPVDEVFFHRYYKKVAVKEKQKRDADEESIEDVD
DEEFEELIDTFEDDNCFSSGKDDMDFAGNVKKRTKGAKDNTLDEDSEGSDDELGNLDDDE
VSLGSMDDEEFAEVDEDGGTFMDVLDDESESVPELEVHSKVSTKKSKRKGTDDFDFAGSF
QGPRKKKRNLNDSSLFVSAEEFGHLLDENMGSKFDNIGMNAMANKDNASLKQLRWEAERD
DWLHNRDAKSIIKKKKHFKKKRIKTTQKTKKQRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03701	1.000	1.000	0.000	1054	1.000	1.000	Q03701.pdb.gz	CEBPZ_HUMAN CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3
2	AFDB:D3ZNU1	0.683	0.689	8.866E-96	1045	0.810	0.817	D3ZNU1.pdb.gz	D3ZNU1_RAT CCAAT/enhancer binding protein zeta OS=Rattus norvegicus OX=10116 GN=Cebpz PE=1 SV=1
3	AFDB:O36021	0.376	0.450	2.832E-38	860	0.262	0.321	O36021.pdb.gz	YEK9_SCHPO Uncharacterized protein C4F10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.09c PE=1 SV=1
4	AFDB:Q386U7	0.488	0.636	1.206E-25	788	0.184	0.246	Q386U7.pdb.gz	Q386U7_TRYB2 CCAAT-binding factor domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0014 PE=3 SV=1
5	PDB:7d5sRO	0.202	0.354	3.448E-6	525	0.087	0.175	7d5sRO.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
6	PDB:7nacI	0.328	0.612	4.034E-6	533	0.067	0.133	7nacI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
7	PDB:7r6kI	0.322	0.632	5.309E-6	508	0.070	0.146	7r6kI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
8	PDB:6zqaUS	0.198	0.383	1.326E-4	473	0.079	0.175	6zqaUS.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
9	AFDB:B5DFK6	0.121	0.110	1.919E-4	1204	0.107	0.094	B5DFK6.pdb.gz	B5DFK6_RAT Adaptor related protein complex 3 subunit delta 1 OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=1 SV=1
10	PDB:3nd2A	0.205	0.244	5.237E-4	861	0.069	0.085	3nd2A.pdb.gz
11	PDB:7owgB	0.129	0.073	1.104E-3	2152	0.061	0.030	7owgB.pdb.gz
12	PDB:7ajuUT	0.147	0.084	1.148E-3	2313	0.063	0.029	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:4r0zA	0.185	0.313	1.194E-3	557	0.077	0.145	4r0zA.pdb.gz
14	PDB:7sukSP	0.170	0.099	1.194E-3	2234	0.054	0.026	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
15	PDB:1b3uA	0.183	0.297	1.511E-3	588	0.047	0.085	1b3uA.pdb.gz
16	AFDB:O15042	0.070	0.071	3.367E-3	1029	0.114	0.117	O15042.pdb.gz	SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2
17	AFDB:F4J8G7	0.169	0.101	6.067E-3	2138	0.110	0.054	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
18	AFDB:F4I6B2	0.157	0.190	1.279E-2	811	0.094	0.122	F4I6B2.pdb.gz	F4I6B2_ARATH SIT4 phosphatase-associated family protein OS=Arabidopsis thaliana OX=3702 GN=At1g30470 PE=1 SV=1
19	AFDB:Q5B1Q9	0.133	0.152	1.023E-1	891	0.113	0.134	Q5B1Q9.pdb.gz	Q5B1Q9_EMENI Dis1/XMAP215 protein AlpA (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=alpA PE=4 SV=1
20	AFDB:Q5C9Z4	0.117	0.137	1.023E-1	860	0.090	0.110	Q5C9Z4.pdb.gz	NOM1_HUMAN Nucleolar MIF4G domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOM1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ASJ7	0.0	1642	1040	0.806	0.817	A0A8I6ASJ7_RAT CCAAT/enhancer binding protein zeta OS=Rattus norvegicus OX=10116 GN=Cebpz PE=1 SV=1
2	A0A8I6AUW9	0.0	1641	1016	0.801	0.831	A0A8I6AUW9_RAT CCAAT/enhancer binding protein zeta OS=Rattus norvegicus OX=10116 GN=Cebpz PE=1 SV=1
3	D3ZNU1	0.0	1678	1045	0.816	0.823	D3ZNU1_RAT CCAAT/enhancer binding protein zeta OS=Rattus norvegicus OX=10116 GN=Cebpz PE=1 SV=1
4	Q03701	0.0	2172	1054	1.000	1.000	CEBPZ_HUMAN CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3
5	O36021	8.75e-124	401	860	0.235	0.288	YEK9_SCHPO Uncharacterized protein C4F10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.09c PE=1 SV=1
6	F4IDC2	1.05e-110	370	1043	0.231	0.234	SWA2_ARATH Protein SLOW WALKER 2 OS=Arabidopsis thaliana OX=3702 GN=SWA2 PE=1 SV=1
7	Q12176	6.31e-97	332	1025	0.213	0.220	MAK21_YEAST Ribosome biogenesis protein MAK21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAK21 PE=1 SV=1
8	Q386U7	1.18e-40	164	788	0.124	0.166	Q386U7_TRYB2 CCAAT-binding factor domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0014 PE=3 SV=1
9	Q6DRN3	1.03e-05	52.0	800	0.066	0.087	NOC3L_DANRE Nucleolar complex protein 3 homolog OS=Danio rerio OX=7955 GN=noc3l PE=2 SV=1
10	F4IDJ0	9.39e-05	48.9	830	0.022	0.028	NOC3_ARATH Nucleolar complex-associated protein 3 OS=Arabidopsis thaliana OX=3702 GN=NOC3 PE=1 SV=1
11	Q06512	3.94e-04	46.6	552	0.048	0.092	NOC4_YEAST Nucleolar complex protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOC4 PE=1 SV=1
12	Q8WTT2	4.52e-04	46.6	800	0.018	0.024	NOC3L_HUMAN Nucleolar complex protein 3 homolog OS=Homo sapiens OX=9606 GN=NOC3L PE=1 SV=1
13	Q8VI84	4.98e-04	46.6	807	0.060	0.078	NOC3L_MOUSE Nucleolar complex protein 3 homolog OS=Mus musculus OX=10090 GN=Noc3l PE=2 SV=2
14	Q9VBP6	0.11	38.9	509	0.026	0.053	Q9VBP6_DROME Succinate-semialdehyde dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Ssadh PE=1 SV=1
15	Q9BVI4	0.22	37.7	516	0.022	0.045	NOC4L_HUMAN Nucleolar complex protein 4 homolog OS=Homo sapiens OX=9606 GN=NOC4L PE=1 SV=1
16	Q9U0I6	0.41	37.0	833	0.051	0.065	Q9U0I6_PLAF7 Erythrocyte vesicle protein 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0410000 PE=4 SV=2
17	A1A5I6	1.4	35.4	780	0.043	0.058	A1A5I6_XENLA Catenin beta 1 S homeolog isoform X2 OS=Xenopus laevis OX=8355 GN=ctnnb1.S PE=2 SV=1
18	P26233	1.4	35.4	781	0.043	0.058	CTNB1_XENLA Catenin beta-1 OS=Xenopus laevis OX=8355 GN=ctnnb1 PE=1 SV=1
19	Q7ZX35	1.4	35.4	781	0.043	0.058	Q7ZX35_XENLA Catenin beta 1 S homeolog OS=Xenopus laevis OX=8355 GN=ctnnb1.S PE=2 SV=1
20	A0A2R8Y5Z1	1.6	35.0	752	0.025	0.035	A0A2R8Y5Z1_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03914 CBF	1.4e-52	189.6	CBF/Mak21 family
2	PF12717 Cnd1	13	17.3	non-SMC mitotic condensation complex subunit 1
3	PF14850 Pro_dh-DNA_bdg	1.3e+02	14.5	DNA-binding domain of Proline dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317992	0.999	Nucleolar complex protein 2 homolog
2	9606.ENSP00000358812	0.999	Protein RRP5 homolog
3	9606.ENSP00000346725	0.990	Pescadillo homolog
4	9606.ENSP00000360412	0.984	Nucleolar complex protein 3 homolog
5	9606.ENSP00000223073	0.983	RNA-binding protein 28
6	9606.ENSP00000258772	0.982	Probable ATP-dependent RNA helicase DDX56
7	9606.ENSP00000354040	0.982	Nucleolar GTP-binding protein 1
8	9606.ENSP00000264279	0.976	Nucleolar protein 58
9	9606.ENSP00000371858	0.976	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
10	9606.ENSP00000407323	0.975	Probable rRNA-processing protein EBP2
11	9606.ENSP00000362153	0.971	Nucleolar GTP-binding protein 2
12	9606.ENSP00000483495	0.969	Probable ATP-dependent RNA helicase DDX27
13	9606.ENSP00000380982	0.963	Pumilio homolog 3
14	9606.ENSP00000446184	0.963	RRP12-like protein
15	9606.ENSP00000402338	0.960	Ribosome production factor 2 homolog
16	9606.ENSP00000261015	0.956	Ribosome biogenesis protein WDR12
17	9606.ENSP00000263239	0.955	ATP-dependent RNA helicase DDX18
18	9606.ENSP00000265245	0.955	Large subunit GTPase 1 homolog
19	9606.ENSP00000238146	0.952	ATP-dependent RNA helicase DDX55
20	9606.ENSP00000254940	0.946	60S ribosome subunit biogenesis protein NIP7 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0003723	1.000	RNA binding
GO:0005515	0.880	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0051173	0.984	positive regulation of nitrogen compound metabolic process
GO:0031325	0.984	positive regulation of cellular metabolic process
GO:0010604	0.983	positive regulation of macromolecule metabolic process
GO:0010468	0.982	regulation of gene expression
GO:2001141	0.975	regulation of RNA biosynthetic process
GO:0006355	0.974	regulation of DNA-templated transcription
GO:0045893	0.955	positive regulation of DNA-templated transcription
GO:0045944	0.847	positive regulation of transcription by RNA polymerase II
GO:0009987	0.620	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.625	nuclear lumen
GO:0005654	0.598	nucleoplasm
GO:0043232	0.585	intracellular non-membrane-bounded organelle
GO:0005737	0.342	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]