StarFunc result for job id Q03828

User Input

>input (476 residues)
MMERIRKEMILMERGLHSPTAGKRFSNLSNSAGNAVLEALENSQHPARLSPRLPSAPLHS
ALGELPAKGKFEIDTLFNLQHTGSESTVSSEISSAAESRKKPGHYSEAAAEADMSSDVEV
GCSALRSPGGLGAAQLKENNGKGYAESGSAAGTTTSASGSGLGSLHGGSGGSGGSAALGG
SGSGADQVRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRR
MKDKRQRLAMSWPHPADPSFYTYMMTHAAATGSLPYPFHSHVPLHYYPHVGVTAAAAAAA
ASGAAAAASSPFATSIRPLDTFRALSHPYSRPELLCSFRHPGLYQAPAAAAGLNSAASAA
AAAAAAAAAASSAAAAGAPPSGGSAPCSCLSCHSSQSAAAAAAAAAAALGSRGGGGGGGG
GGGGGGGGAGAGGGSDFGCSAAAPRSESGFLPYSAAVLSKTAVSPPDQRDEAPLTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03828	0.999	0.999	1.363E-65	476	1.000	1.000	Q03828.pdb.gz	EVX2_HUMAN Homeobox even-skipped homolog protein 2 OS=Homo sapiens OX=9606 GN=EVX2 PE=1 SV=2
2	AFDB:P23683	0.210	0.238	2.925E-25	416	0.460	0.526	P23683.pdb.gz	EVX1_MOUSE Homeobox even-skipped homolog protein 1 OS=Mus musculus OX=10090 GN=Evx1 PE=2 SV=1
3	AFDB:Q9YH70	0.165	0.225	1.562E-9	334	0.160	0.228	Q9YH70.pdb.gz	Q9YH70_XENLA VENT homeobox 2, gene 2 S homeolog OS=Xenopus laevis OX=8355 GN=ventx2.2.S PE=4 SV=1
4	AFDB:Q24256	0.142	0.106	2.055E-9	645	0.214	0.158	Q24256.pdb.gz	BARH2_DROME Homeobox protein B-H2 OS=Drosophila melanogaster OX=7227 GN=B-H2 PE=1 SV=3
5	AFDB:P97503	0.151	0.208	1.609E-8	333	0.158	0.225	P97503.pdb.gz	NKX32_MOUSE Homeobox protein Nkx-3.2 OS=Mus musculus OX=10090 GN=Nkx3-2 PE=1 SV=2
6	AFDB:A5JNG8	0.146	0.179	4.202E-8	384	0.151	0.188	A5JNG8.pdb.gz	A5JNG8_DANRE Nanog OS=Danio rerio OX=7955 GN=fd20a07 PE=2 SV=1
7	AFDB:O42477	0.152	0.180	1.025E-7	393	0.164	0.198	O42477.pdb.gz	VSX2_DANRE Visual system homeobox 2 OS=Danio rerio OX=7955 GN=vsx2 PE=2 SV=3
8	AFDB:P92953	0.135	0.201	3.289E-7	318	0.145	0.217	P92953.pdb.gz	ATHB4_ARATH Homeobox-leucine zipper protein ATHB-4 OS=Arabidopsis thaliana OX=3702 GN=ATHB-4 PE=1 SV=1
9	AFDB:P46665	0.119	0.168	4.635E-7	336	0.134	0.190	P46665.pdb.gz	HAT14_ARATH Homeobox-leucine zipper protein HAT14 OS=Arabidopsis thaliana OX=3702 GN=HAT14 PE=2 SV=3
10	AFDB:Q6ZNG2	0.136	0.188	6.995E-7	339	0.162	0.227	Q6ZNG2.pdb.gz	DBX2_HUMAN Homeobox protein DBX2 OS=Homo sapiens OX=9606 GN=DBX2 PE=2 SV=2
11	PDB:4egcA	0.100	0.089	7.581E-3	539	0.032	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.115	0.625	5.173E-2	73	0.032	0.205	2hi3A.pdb.gz
13	PDB:7fbyA	0.090	0.241	1.550E-1	153	0.027	0.085	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5gadi	0.110	0.116	1.392	450	0.023	0.024	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
15	PDB:5mrca	0.078	0.190	1.491	177	0.023	0.062	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
16	PDB:2h09A	0.057	0.169	1.596	127	0.023	0.087	2h09A.pdb.gz
17	PDB:6qdvO	0.094	0.101	1.596	441	0.036	0.039	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
18	PDB:2cg4A	0.087	0.234	1.831	149	0.021	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
19	PDB:7awtE	0.069	0.197	1.831	156	0.013	0.038	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
20	PDB:5aj0BZ	0.090	0.402	1.961	86	0.019	0.105	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49749	0.0	668	475	0.920	0.922	EVX2_MOUSE Homeobox even-skipped homolog protein 2 OS=Mus musculus OX=10090 GN=Evx2 PE=2 SV=1
2	Q03828	0.0	936	476	1.000	1.000	EVX2_HUMAN Homeobox even-skipped homolog protein 2 OS=Homo sapiens OX=9606 GN=EVX2 PE=1 SV=2
3	Q6PFR9	0.0	528	418	0.662	0.754	Q6PFR9_DANRE Even-skipped homeobox 2 OS=Danio rerio OX=7955 GN=Evx-2 PE=2 SV=1
4	A0A0R4IVI8	3.94e-102	312	377	0.376	0.475	A0A0R4IVI8_DANRE Even-skipped homeobox 1 OS=Danio rerio OX=7955 GN=cb416 PE=4 SV=1
5	P49640	2.83e-101	311	407	0.452	0.528	EVX1_HUMAN Homeobox even-skipped homolog protein 1 OS=Homo sapiens OX=9606 GN=EVX1 PE=2 SV=1
6	P23683	2.86e-97	301	416	0.464	0.531	EVX1_MOUSE Homeobox even-skipped homolog protein 1 OS=Mus musculus OX=10090 GN=Evx1 PE=2 SV=1
7	F1R6B2	5.04e-43	153	224	0.155	0.330	F1R6B2_DANRE Even-skipped-like1 OS=Danio rerio OX=7955 GN=cb872 PE=4 SV=1
8	Q90265	8.43e-43	153	223	0.155	0.332	Q90265_DANRE EVE1 OS=Danio rerio OX=7955 GN=evx3 PE=2 SV=1
9	P06602	4.22e-38	144	376	0.137	0.173	EVE_DROME Segmentation protein even-skipped OS=Drosophila melanogaster OX=7227 GN=eve PE=1 SV=3
10	Q93899	2.17e-30	120	247	0.118	0.227	VAB7_CAEEL Homeobox protein vab-7 OS=Caenorhabditis elegans OX=6239 GN=vab-7 PE=1 SV=2
11	P31264	3.09e-18	90.1	782	0.078	0.047	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
12	P0C1T1	3.73e-18	87.8	354	0.088	0.119	HXB2_MOUSE Homeobox protein Hox-B2 OS=Mus musculus OX=10090 GN=Hoxb2 PE=2 SV=1
13	P31245	4.72e-18	87.8	372	0.084	0.108	HXA2_MOUSE Homeobox protein Hox-A2 OS=Mus musculus OX=10090 GN=Hoxa2 PE=2 SV=1
14	P14652	4.90e-18	87.4	356	0.101	0.135	HXB2_HUMAN Homeobox protein Hox-B2 OS=Homo sapiens OX=9606 GN=HOXB2 PE=1 SV=1
15	P31246	5.18e-18	87.8	372	0.084	0.108	HXA2_RAT Homeobox protein Hox-A2 OS=Rattus norvegicus OX=10116 GN=Hoxa2 PE=2 SV=1
16	O43364	5.52e-18	87.8	376	0.084	0.106	HXA2_HUMAN Homeobox protein Hox-A2 OS=Homo sapiens OX=9606 GN=HOXA2 PE=1 SV=1
17	P52945	1.45e-17	85.1	283	0.082	0.138	PDX1_HUMAN Pancreas/duodenum homeobox protein 1 OS=Homo sapiens OX=9606 GN=PDX1 PE=1 SV=1
18	P52946	1.68e-17	84.7	284	0.082	0.137	PDX1_MOUSE Pancreas/duodenum homeobox protein 1 OS=Mus musculus OX=10090 GN=Pdx1 PE=1 SV=1
19	P52947	1.89e-17	84.7	283	0.078	0.131	PDX1_RAT Pancreas/duodenum homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Pdx1 PE=1 SV=1
20	P32442	5.83e-17	82.8	253	0.078	0.146	MEOX1_MOUSE Homeobox protein MOX-1 OS=Mus musculus OX=10090 GN=Meox1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.5e-17	74.5	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312385

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272748	0.838	Endoplasmic reticulum junction formation protein lunapark
2	9606.ENSP00000249442	0.728	Metaxin-2
3	9606.ENSP00000324124	0.703	DNA-directed RNA polymerases I, II, and III subunit RPABC5
4	9606.ENSP00000377001	0.579	Speckle-type POZ protein
5	9606.ENSP00000401437	0.523	LIM domain-binding protein 3
6	9606.ENSP00000357979	0.502	Nuclear receptor subfamily 2 group E member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.959	transcription regulator activity
GO:0003700	0.952	DNA-binding transcription factor activity
GO:0000981	0.836	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.377	transcription cis-regulatory region binding
GO:0000977	0.348	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.989	anatomical structure development
GO:0032501	0.987	multicellular organismal process
GO:0007275	0.968	multicellular organism development
GO:0050789	0.867	regulation of biological process
GO:0050794	0.863	regulation of cellular process
GO:0009653	0.808	anatomical structure morphogenesis
GO:0035107	0.787	appendage morphogenesis
GO:0009987	0.753	cellular process
GO:0048731	0.748	system development
GO:0035108	0.745	limb morphogenesis
GO:0060255	0.701	regulation of macromolecule metabolic process
GO:0019219	0.695	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.660	regulation of gene expression
GO:1903506	0.658	regulation of nucleic acid-templated transcription
GO:0006355	0.653	regulation of DNA-templated transcription
GO:0048513	0.461	animal organ development
GO:0006357	0.348	regulation of transcription by RNA polymerase II
GO:0048519	0.334	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.985	nucleoplasm
GO:0005737	0.536	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]