StarFunc result for job id Q03933

User Input

>input (536 residues)
MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMAS
FVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENK
IRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQ
FIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVPHSRTEGLKPRE
RISDDIIIYDVTDDNADEENIPVIPETNEDVISDPSNCSQYPDIVIVEDDNEDEYAPVIQ
SGEQNEPARESLSSGSDGSSPLMSSAVQLNGSSSLTSEDPVTMMDSILNDNINLLGKVEL
LDYLDSIDCSLEDFQAMLSGRQFSIDPDLLVDLFTSSVQMNPTDYINNTKSENKGLETTK
NNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKP
IEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03933	1.000	1.000	1.421E-81	536	1.000	1.000	Q03933.pdb.gz	HSF2_HUMAN Heat shock factor protein 2 OS=Homo sapiens OX=9606 GN=HSF2 PE=1 SV=1
2	AFDB:P38530	0.429	0.411	2.576E-63	564	0.800	0.761	P38530.pdb.gz	HSF2_CHICK Heat shock factor protein 2 OS=Gallus gallus OX=9031 GN=HSF2 PE=2 SV=1
3	AFDB:Q7SZW8	0.438	0.478	1.716E-46	489	0.541	0.593	Q7SZW8.pdb.gz
4	AFDB:Q8AWA0	0.348	0.364	1.117E-43	511	0.537	0.564	Q8AWA0.pdb.gz	Q8AWA0_ONCMY Heat shock factor 2 OS=Oncorhynchus mykiss OX=8022 GN=hsf2 PE=2 SV=1
5	AFDB:P38531	0.393	0.445	4.755E-29	467	0.312	0.358	P38531.pdb.gz	HSF3_CHICK Heat shock factor protein 3 OS=Gallus gallus OX=9031 GN=HSF3 PE=1 SV=1
6	AFDB:Q00613	0.357	0.362	1.381E-27	529	0.366	0.371	Q00613.pdb.gz	HSF1_HUMAN Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1
7	AFDB:Q76M53	0.330	0.344	1.789E-27	513	0.330	0.345	Q76M53.pdb.gz	Q76M53_ONCMY Heat shock transcription factor 1 isoform b OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
8	AFDB:F1MAF1	0.408	0.416	2.318E-27	525	0.341	0.349	F1MAF1.pdb.gz	F1MAF1_RAT Heat shock transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=1 SV=2
9	AFDB:Q76M54	0.322	0.343	1.028E-26	501	0.330	0.353	Q76M54.pdb.gz	Q76M54_ONCMY Heat shock transcription factor 1 isoform a OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
10	AFDB:P38529	0.351	0.381	1.619E-26	491	0.345	0.377	P38529.pdb.gz	HSF1_CHICK Heat shock factor protein 1 OS=Gallus gallus OX=9031 GN=HSF1 PE=1 SV=1
11	PDB:7nshBG	0.079	0.174	1.074	196	0.021	0.056	7nshBG.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
12	PDB:5txrA	0.096	0.106	1.222	479	0.026	0.029	5txrA.pdb.gz	Structure of the Mitochondrial Aminolevulinic Acid Synthase, a Key Heme Biosynthetic Enzyme.
13	PDB:5a0mB	0.077	0.152	1.304	227	0.017	0.040	5a0mB.pdb.gz	Structure of the I-Scei Nuclease Complexed with its DsDNA Target and Three Catalytic Metal Ions.
14	PDB:1qk1A	0.082	0.110	1.803	379	0.015	0.021	1qk1A.pdb.gz
15	PDB:4z9mC	0.076	0.101	2.659	375	0.019	0.027	4z9mC.pdb.gz	Crystal structure of human sarcomeric mitochondrial creatine kinase
16	PDB:4kddA	0.089	0.210	2.837	184	0.009	0.027	4kddA.pdb.gz	Molecular flexibility of Mycobacterium tuberculosis ribosome recycling factor and its functional consequences: an exploration involving mutants.
17	PDB:3cueE	0.073	0.168	3.676	188	0.028	0.080	3cueE.pdb.gz
18	PDB:1qh4D	0.063	0.084	4.465	380	0.017	0.024	1qh4D.pdb.gz	Crystal structure of brain-type creatine kinase at 1.41 A resolution.
19	PDB:3owcA	0.082	0.208	4.465	172	0.028	0.087	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
20	PDB:5loeA	0.104	0.189	4.764	258	0.034	0.070	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P38530	0.0	846	564	0.800	0.761	HSF2_CHICK Heat shock factor protein 2 OS=Gallus gallus OX=9031 GN=HSF2 PE=2 SV=1
2	P38533	0.0	1019	535	0.946	0.948	HSF2_MOUSE Heat shock factor protein 2 OS=Mus musculus OX=10090 GN=Hsf2 PE=1 SV=2
3	Q03933	0.0	1092	536	1.000	1.000	HSF2_HUMAN Heat shock factor protein 2 OS=Homo sapiens OX=9606 GN=HSF2 PE=1 SV=1
4	Q90XA8	2.23e-180	518	489	0.550	0.603	Q90XA8_DANRE Heat shock factor Hsf2 OS=Danio rerio OX=7955 GN=zfHSF2 PE=2 SV=1
5	A0A060W590	2.35e-179	516	503	0.547	0.583	A0A060W590_ONCMY HSF-type DNA-binding domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00066731001 PE=3 SV=1
6	Q8AWA0	2.45e-178	513	511	0.545	0.571	Q8AWA0_ONCMY Heat shock factor 2 OS=Oncorhynchus mykiss OX=8022 GN=hsf2 PE=2 SV=1
7	V9GZ44	1.01e-146	422	214	0.399	1.000	V9GZ44_HUMAN Heat shock transcription factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=HSF2 PE=1 SV=1
8	P38531	2.95e-94	296	467	0.308	0.353	HSF3_CHICK Heat shock factor protein 3 OS=Gallus gallus OX=9031 GN=HSF3 PE=1 SV=1
9	P38529	9.22e-90	286	491	0.340	0.371	HSF1_CHICK Heat shock factor protein 1 OS=Gallus gallus OX=9031 GN=HSF1 PE=1 SV=1
10	Q76M53	4.51e-88	282	513	0.330	0.345	Q76M53_ONCMY Heat shock transcription factor 1 isoform b OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
11	Q1LXV0	8.28e-88	281	497	0.356	0.384	Q1LXV0_DANRE Heat shock factor protein 1 OS=Danio rerio OX=7955 GN=HSF PE=1 SV=2
12	Q76M54	1.13e-81	265	501	0.330	0.353	Q76M54_ONCMY Heat shock transcription factor 1 isoform a OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
13	E9PMQ6	6.47e-81	263	495	0.231	0.251	E9PMQ6_HUMAN Heat shock transcription factor 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=2
14	Q00613	7.45e-81	264	529	0.231	0.234	HSF1_HUMAN Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1
15	Q5CZP2	3.85e-80	259	441	0.306	0.372	HSF4_DANRE Heat shock factor protein 4 OS=Danio rerio OX=7955 GN=hsf4 PE=2 SV=2
16	A0A8I6ADR2	2.36e-79	257	432	0.226	0.280	A0A8I6ADR2_RAT Heat shock transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=3 SV=1
17	F6P697	3.46e-79	259	523	0.228	0.233	F6P697_DANRE Heat shock factor protein 1 isoform X1 OS=Danio rerio OX=7955 GN=HSF PE=1 SV=1
18	P38532	5.16e-79	259	525	0.229	0.234	HSF1_MOUSE Heat shock factor protein 1 OS=Mus musculus OX=10090 GN=Hsf1 PE=1 SV=2
19	F1MAF1	1.28e-78	259	553	0.226	0.219	F1MAF1_RAT Heat shock transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=1 SV=2
20	A0A8I6AMW4	1.52e-78	258	531	0.226	0.228	A0A8I6AMW4_RAT Heat shock transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	93	14.9	Apg6 coiled-coil region
2	PF00170 bZIP_1	1.6e+02	13.8	bZIP transcription factor
3	PF07716 bZIP_2	64	15.0	Basic region leucine zipper
4	PF02183 HALZ	1.4e+02	14.1	Homeobox associated leucine zipper
5	PF04849 HAP1_N	26	15.5	HAP1 N-terminal conserved region
6	PF00447 HSF_DNA-bind	1.4e-30	117.1	HSF-type DNA-binding
7	PF04791 LMBR1	4.3e+02	11.2	LMBR1-like membrane protein
8	PF06546 Vert_HS_TF	1.4e-85	299.0	Vertebrate heat shock transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357440

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246672	0.936	Nuclear receptor subfamily 1 group D member 1
2	9606.ENSP00000478187	0.934	Cryptochrome-2
3	9606.ENSP00000360266	0.918	Transcription factor AP-1
4	9606.ENSP00000305422	0.910	CCAAT/enhancer-binding protein beta
5	9606.ENSP00000405330	0.906	Estrogen receptor
6	9606.ENSP00000431512	0.887	Heat shock factor protein 1
7	9606.ENSP00000331462	0.881	Transcription factor which binds to RE2 sequence elements in the MYOD1 enhancer
8	9606.ENSP00000294954	0.764	Lutropin-choriogonadotropic hormone receptor
9	9606.ENSP00000296582	0.736	Transmembrane protein 184C
10	9606.ENSP00000240651	0.722	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1
11	9606.ENSP00000319255	0.713	Cysteine and histidine-rich domain-containing protein 1
12	9606.ENSP00000347839	0.707	Rab11 family-interacting protein 2
13	9606.ENSP00000359607	0.701	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2
14	9606.ENSP00000254928	0.647	GTPase Era, mitochondrial
15	9606.ENSP00000368140	0.647	Cardiolipin synthase (CMP-forming)
16	9606.ENSP00000351446	0.637	WD repeat-containing protein 5
17	9606.ENSP00000309175	0.623	Probable RNA-binding protein EIF1AD
18	9606.ENSP00000299767	0.622	Endoplasmin
19	9606.ENSP00000335153	0.616	Heat shock protein HSP 90-alpha
20	9606.ENSP00000402033	0.605	PDZ domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0000987	0.975	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.965	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.951	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.944	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.824	identical protein binding
GO:0042803	0.656	protein homodimerization activity
GO:0001162	0.479	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding
GO:0001046	0.313	core promoter sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0080090	0.977	regulation of primary metabolic process
GO:0051171	0.951	regulation of nitrogen compound metabolic process
GO:0009987	0.942	cellular process
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0050794	0.915	regulation of cellular process
GO:0031323	0.835	regulation of cellular metabolic process
GO:0009889	0.774	regulation of biosynthetic process
GO:0010468	0.770	regulation of gene expression
GO:0048518	0.753	positive regulation of biological process
GO:0010556	0.706	regulation of macromolecule biosynthetic process
GO:0048522	0.703	positive regulation of cellular process
GO:0031326	0.697	regulation of cellular biosynthetic process
GO:0019219	0.696	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.685	positive regulation of macromolecule metabolic process
GO:0006357	0.664	regulation of transcription by RNA polymerase II
GO:0031325	0.655	positive regulation of cellular metabolic process
GO:0051173	0.647	positive regulation of nitrogen compound metabolic process
GO:0050896	0.584	response to stimulus
GO:0048519	0.511	negative regulation of biological process
GO:0045935	0.481	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.413	positive regulation of RNA metabolic process
GO:0010557	0.411	positive regulation of macromolecule biosynthetic process
GO:0045893	0.389	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.975	cytoplasm
GO:0005829	0.462	cytosol
GO:0043232	0.415	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]