StarFunc result for job id Q03938

User Input

>input (601 residues)
MGPLEFRDVAIEFSLEEWHCLDTAQQNLYRDVMLENYRHLVFLGIVVTKPDLITCLEQGK
KPFTVKRHEMIAKSPVMCFHFAQDLCPEQSLKDSFQKVIVTRYEKREYGNLELKKGCESV
DEGKVHKRGYNGLNQCLTATQSKVFQCDTYVKVSHIFSNSNRHKIRDTGKKPFKCIECGK
AFNQSSTLATHKKIHTGEITCKCEECGKAFNRSSHLTSHKRIHTGEKRYKCEDCGKELKY
SSTLTAHKRIHTGEKRYKCEDCGKELKYSSTLTAHKRIHTGEKPYKCDKCGRAFISSSIL
YVHKISHTEEKPYKCEECGKAFKLSSILSTHKRIHTGEKPYKCEECGKAFRRSLVLRTHK
RIHTGEKPYKCDKCGKAFISSSLLYKHKISHSEKKPYKCEECGKAFKRSSTLTIHKISHT
EEKPYKCQECDKVFKRSSALSTHKIIHSGEKPYKCEECGKAFKRSSNLTTHKISHTEEKL
YKCQECDKAFKYSSALSTHKIIHSGENPYKCEECGKAFKRSSVLSKHKIIHTGAKPYKCE
ECGKAFKRSSQLTSHKISHTGEKPYKCEECGKAFNLSSDLNTHKRIHIGQKAYIVKNMAN
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03923	0.573	0.578	1.134E-72	595	0.702	0.709	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
2	AFDB:A6NNF4	0.519	0.437	1.652E-71	738	0.681	0.554	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
3	AFDB:P35789	0.534	0.520	3.185E-71	620	0.710	0.689	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
4	AFDB:Q05481	0.493	0.283	2.393E-69	1191	0.687	0.347	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
5	AFDB:Q03936	0.511	0.522	3.069E-65	586	0.657	0.674	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
6	AFDB:O75437	0.464	0.431	6.598E-65	659	0.677	0.618	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
7	AFDB:P17038	0.435	0.343	1.418E-64	809	0.687	0.511	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
8	AFDB:Q8IYB9	0.485	0.456	6.208E-64	648	0.611	0.566	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
9	AFDB:Q8TD23	0.308	0.324	2.421E-62	568	0.639	0.676	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
10	AFDB:Q14593	0.231	0.243	3.162E-61	569	0.609	0.643	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
11	PDB:3w5kB	0.083	0.278	1.968E-4	110	0.070	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.052	0.224	1.543	96	0.032	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:8a5yT	0.057	0.054	1.630	650	0.095	0.088	8a5yT.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex and comparison to apo unphosphorylated and phosphorylated states
14	PDB:7ena4	0.068	0.083	2.028	457	0.077	0.101	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:7cunA	0.106	0.094	2.815	730	0.077	0.063	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
16	PDB:5gm6a	0.031	0.109	3.141	123	0.045	0.220	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6r5kO	0.066	0.084	3.317	447	0.027	0.036	6r5kO.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
18	PDB:5gm6P	0.048	0.097	3.908	246	0.048	0.118	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:7mq9SI	0.072	0.053	4.128	844	0.027	0.019	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6ff79	0.066	0.078	4.605	432	0.077	0.106	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	782	616	0.666	0.649	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	791	659	0.692	0.631	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	563	809	0.502	0.373	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	840	620	0.710	0.689	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	828	595	0.702	0.709	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	762	586	0.659	0.676	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	546	1191	0.494	0.249	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	690	569	0.587	0.620	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	568	474	0.479	0.608	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	693	569	0.584	0.617	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q49A12	700	536	0.606	0.679	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
12	Q5JVG8	618	444	0.509	0.689	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
13	Q6ZR52	545	646	0.496	0.461	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
14	Q8IW36	525	515	0.464	0.542	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
15	Q8IYB9	747	648	0.649	0.602	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
16	Q8IYN0	651	542	0.551	0.611	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
17	Q8TAQ5	561	688	0.511	0.446	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
18	Q8TD23	728	568	0.632	0.669	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
19	Q96H40	639	463	0.534	0.693	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
20	Q96JC4	625	524	0.536	0.615	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06719 AraC_N	1e+02	14.0	AraC-type transcriptional regulator N-terminus
2	PF07975 C1_4	63	15.2	TFIIH C1-like domain
3	PF01352 KRAB	2.2e-18	76.9	KRAB box
4	PF18238 LnmK_N_HDF	15	16.8	LnmK N-terminal Hot Dog Fold domain
5	PF01409 tRNA-synt_2d	6.2e+02	11.2	tRNA synthetases class II core domain (F)
6	PF01286 XPA_N	7.9e-22	88.3	XPA protein N-terminal
7	PF01428 zf-AN1	76	14.9	AN1-like Zinc finger
8	PF00096 zf-C2H2	3.7e-75	255.5	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	2e-07	42.0	zinc-finger C2H2-type
10	PF13894 zf-C2H2_4	1.2e-42	151.9	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	1.2e-29	112.9	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	5.3e-25	98.4	Zinc-finger double-stranded RNA-binding
13	PF13465 zf-H2C2_2	1.6e-105	352.6	Zinc-finger double domain
14	PF12874 zf-met	5.7	18.7	Zinc-finger of C2H2 type
15	PF18439 zf_UBZ	1.2e-17	74.5	Ubiquitin-Binding Zinc Finger
16	PF17032 zinc_ribbon_15	0.04	26.0	zinc-ribbon family
17	PF09723 Zn-ribbon_8	4.3e-12	57.3	Zinc ribbon domain
18	PF17283 Zn_ribbon_SprT	1.1e-05	36.6	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410466

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389243	0.504	Zinc finger protein with KRAB and SCAN domains 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.982	biological regulation
GO:0050794	0.963	regulation of cellular process
GO:0019222	0.952	regulation of metabolic process
GO:0009889	0.939	regulation of biosynthetic process
GO:0010468	0.939	regulation of gene expression
GO:0019219	0.939	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.925	negative regulation of cellular process
GO:0031324	0.910	negative regulation of cellular metabolic process
GO:0045934	0.806	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.800	negative regulation of RNA metabolic process
GO:0031327	0.793	negative regulation of cellular biosynthetic process
GO:0045892	0.777	negative regulation of DNA-templated transcription
GO:0009987	0.609	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.994	nuclear lumen
GO:0005654	0.922	nucleoplasm
GO:0043232	0.835	intracellular non-membrane-bounded organelle
GO:0005737	0.820	cytoplasm
GO:0005730	0.373	nucleolus
GO:0012505	0.308	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]