StarFunc result for job id Q03989

User Input

>input (594 residues)
MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGEREEEQEREEEQA
FLVSLYKFMKERHTPIERVPHLGFKQINLWKIYKAVEKLGAYELVTGRRLWKNVYDELGG
SPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPK
KAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYK
RLLSSFYCKGTHGIMSPLAKKKLLAQVSKVEALQCQEEGCRHGAEPQASPAVHLPESPQS
PKGLTENSRHRLTPQEGLQAPGGSLREEAQAGPCPAAPIFKGCFYTHPTEVLKPVSQHPR
DFFSRLKDGVLLGPPGKEGLSVKEPQLVWGGDANRPSAFHKGGSRKGILYPKPKACWVSP
MAKVPAESPTLPPTFPSSPGLGSKRSLEEEGAAHSGKRLRAVSPFLKEADAKKCGAKPAG
SGLVSCLLGPALGPVPPEAYRGTMLHCPLNFTGTPGPLKGQAALPFSPLVIPAFPAHFLA
TAGPSPMAAGLMHFPPTSFDSALRHRLCPASSAWHAPPVTTYAAPHFFHLNTKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03989	0.999	0.999	1.037E-81	594	1.000	1.000	Q03989.pdb.gz	ARI5A_HUMAN AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=2
2	AFDB:Q3U108	0.251	0.252	3.068E-60	590	0.769	0.775	Q3U108.pdb.gz	ARI5A_MOUSE AT-rich interactive domain-containing protein 5A OS=Mus musculus OX=10090 GN=Arid5a PE=1 SV=1
3	AFDB:A0A669KBH0	0.202	0.356	3.046E-36	327	0.468	0.850	A0A669KBH0.pdb.gz	A0A669KBH0_HUMAN AT-rich interaction domain 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=1
4	AFDB:Q9VWP5	0.164	0.041	1.859E-5	2486	0.175	0.042	Q9VWP5.pdb.gz	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
5	AFDB:E9Q4N7	0.160	0.049	3.018E-5	2244	0.177	0.047	E9Q4N7.pdb.gz	ARI1B_MOUSE AT-rich interactive domain-containing protein 1B OS=Mus musculus OX=10090 GN=Arid1b PE=1 SV=2
6	AFDB:Q8NFD5	0.166	0.049	2.515E-3	2236	0.172	0.046	Q8NFD5.pdb.gz	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
7	AFDB:Q9H0W5	0.062	0.066	9.538E-3	538	0.126	0.139	Q9H0W5.pdb.gz	CCDC8_HUMAN Coiled-coil domain-containing protein 8 OS=Homo sapiens OX=9606 GN=CCDC8 PE=1 SV=2
8	AFDB:O14497	0.172	0.047	1.372E-2	2285	0.178	0.046	O14497.pdb.gz	ARI1A_HUMAN AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3
9	AFDB:E9AFM3	0.063	0.050	1.857E-2	796	0.184	0.137	E9AFM3.pdb.gz	E9AFM3_LEIMA 4E-interacting protein OS=Leishmania major OX=5664 GN=LMJF_35_3980 PE=1 SV=1
10	AFDB:Q9ZWJ9	0.083	0.075	2.227E-2	664	0.140	0.125	Q9ZWJ9.pdb.gz	ARR2_ARATH Two-component response regulator ARR2 OS=Arabidopsis thaliana OX=3702 GN=ARR2 PE=1 SV=1
11	PDB:4zzlA	0.076	0.197	2.523	146	0.032	0.130	4zzlA.pdb.gz
12	PDB:6hivDH	0.054	0.057	2.681	564	0.062	0.066	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
13	PDB:5v5zA	0.053	0.060	2.848	488	0.022	0.027	5v5zA.pdb.gz	Crystal Structures of Full-Length Lanosterol 14 alpha-Demethylases of Prominent Fungal Pathogens Candida albicans and Candida glabrata Provide Tools for Antifungal Discovery.
14	PDB:1cnt1	0.064	0.157	4.625	150	0.012	0.047	1cnt1.pdb.gz
15	PDB:3b99B	0.062	0.079	4.914	415	0.029	0.041	3b99B.pdb.gz	Structures of Prostacyclin Synthase and Its Complexes with Substrate Analog and Inhibitor Reveal a Ligand-specific Heme Conformation Change
16	PDB:6zx9C	0.065	0.127	5.221	257	0.025	0.058	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
17	PDB:7p5tA	0.074	0.103	5.221	396	0.015	0.023	7p5tA.pdb.gz	Structure of CYP142 from Mycobacterium tuberculosis in complex with inhibitor MEK216
18	PDB:7r6k7	0.061	0.247	5.221	109	0.022	0.119	7r6k7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
19	PDB:7sqkE	0.062	0.061	5.547	610	0.032	0.031	7sqkE.pdb.gz
20	PDB:2zpaB	0.059	0.054	6.652	662	0.020	0.018	2zpaB.pdb.gz	RNA helicase module in an acetyltransferase that modifies a specific tRNA anticodon

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A669KBH0	0.0	541	327	0.448	0.813	A0A669KBH0_HUMAN AT-rich interaction domain 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=1
2	Q03989	0.0	1204	594	1.000	1.000	ARI5A_HUMAN AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=2
3	Q3U108	0.0	846	590	0.766	0.771	ARI5A_MOUSE AT-rich interactive domain-containing protein 5A OS=Mus musculus OX=10090 GN=Arid5a PE=1 SV=1
4	Q8BM75	1.02e-51	194	1188	0.160	0.080	ARI5B_MOUSE AT-rich interactive domain-containing protein 5B OS=Mus musculus OX=10090 GN=Arid5b PE=1 SV=3
5	Q14865	1.52e-51	193	1188	0.162	0.081	ARI5B_HUMAN AT-rich interactive domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ARID5B PE=1 SV=3
6	Q9VWP5	1.40e-15	83.2	2486	0.059	0.014	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
7	Q4LE39	1.58e-11	70.1	1312	0.069	0.031	ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B PE=1 SV=2
8	Q8IN94	3.27e-11	69.3	2716	0.074	0.016	OSA_DROME Trithorax group protein osa OS=Drosophila melanogaster OX=7227 GN=osa PE=1 SV=1
9	A2CG63	3.39e-11	68.9	1314	0.045	0.021	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
10	Q9Z1N7	4.50e-09	61.6	568	0.062	0.065	ARI3B_MOUSE AT-rich interactive domain-containing protein 3B OS=Mus musculus OX=10090 GN=Arid3b PE=1 SV=1
11	E9Q7E2	4.96e-09	62.0	1828	0.056	0.018	ARID2_MOUSE AT-rich interactive domain-containing protein 2 OS=Mus musculus OX=10090 GN=Arid2 PE=1 SV=1
12	Q68CP9	6.14e-09	61.6	1835	0.056	0.018	ARID2_HUMAN AT-rich interactive domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARID2 PE=1 SV=2
13	Q8IVW6	6.48e-09	61.2	561	0.062	0.066	ARI3B_HUMAN AT-rich interactive domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ARID3B PE=1 SV=2
14	B7ZP08	7.41e-09	60.5	379	0.059	0.092	B7ZP08_MOUSE AT-rich interactive domain-containing protein 3 OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=1
15	A6PWV5	9.84e-09	60.1	409	0.045	0.066	ARI3C_MOUSE AT-rich interactive domain-containing protein 3C OS=Mus musculus OX=10090 GN=Arid3c PE=2 SV=2
16	P29374	1.12e-08	60.8	1257	0.049	0.023	ARI4A_HUMAN AT-rich interactive domain-containing protein 4A OS=Homo sapiens OX=9606 GN=ARID4A PE=1 SV=3
17	A6NKF2	1.35e-08	59.7	412	0.051	0.073	ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens OX=9606 GN=ARID3C PE=1 SV=1
18	Q99856	2.19e-08	59.3	593	0.044	0.044	ARI3A_HUMAN AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2
19	Q62431	2.38e-08	59.3	601	0.044	0.043	ARI3A_MOUSE AT-rich interactive domain-containing protein 3A OS=Mus musculus OX=10090 GN=Arid3a PE=1 SV=1
20	F8VPQ2	3.46e-08	59.3	1261	0.049	0.023	ARI4A_MOUSE AT-rich interactive domain-containing protein 4A OS=Mus musculus OX=10090 GN=Arid4a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	5.5e-12	57.6	ARID/BRIGHT DNA binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350078

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244769	0.716	Ataxin-1
2	9606.ENSP00000245479	0.713	Transcription factor SOX-9
3	9606.ENSP00000339484	0.711	Zinc finger AN1-type containing 4
4	9606.ENSP00000363431	0.708	Neuropeptide Y receptor type 4
5	9606.ENSP00000257940	0.676	Zinc finger CCCH domain-containing protein 10
6	9606.ENSP00000362179	0.664	Endoribonuclease ZC3H12A
7	9606.ENSP00000364550	0.650	Lysine-specific demethylase 5C
8	9606.ENSP00000363482	0.641	WASH complex subunit 2C
9	9606.ENSP00000354652	0.630	Neuropeptide Y receptor type 1
10	9606.ENSP00000377036	0.629	Serine/threonine-protein phosphatase 2A activator
11	9606.ENSP00000398273	0.611	Transcription factor SOX-5
12	9606.ENSP00000262133	0.608	Retinoblastoma-like protein 2
13	9606.ENSP00000354206	0.565	Zinc finger protein 219
14	9606.ENSP00000282633	0.563	WASH complex subunit 2A
15	9606.ENSP00000263121	0.531	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
16	9606.ENSP00000356669	0.526	Roquin-1
17	9606.ENSP00000429896	0.508	Protein FAM178B
18	9606.ENSP00000373360	0.507	Protein FAM131A
19	9606.ENSP00000410470	0.503	Fumarylacetoacetate hydrolase domain-containing protein 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.999	transcription regulator activity
GO:0043565	0.996	sequence-specific DNA binding
GO:0003712	0.985	transcription coregulator activity
GO:0140297	0.982	DNA-binding transcription factor binding
GO:0061629	0.945	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003714	0.942	transcription corepressor activity
GO:0016922	0.933	nuclear receptor binding
GO:0042974	0.924	nuclear retinoic acid receptor binding
GO:0046965	0.911	nuclear retinoid X receptor binding
GO:0046966	0.909	nuclear thyroid hormone receptor binding
GO:0050681	0.901	nuclear androgen receptor binding
GO:0030331	0.898	nuclear estrogen receptor binding
GO:0042802	0.895	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0080090	0.988	regulation of primary metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0010468	0.987	regulation of gene expression
GO:0051252	0.980	regulation of RNA metabolic process
GO:0006355	0.968	regulation of DNA-templated transcription
GO:0051716	0.960	cellular response to stimulus
GO:0006357	0.958	regulation of transcription by RNA polymerase II
GO:0048519	0.944	negative regulation of biological process
GO:0048523	0.923	negative regulation of cellular process
GO:0010605	0.918	negative regulation of macromolecule metabolic process
GO:0010033	0.906	response to organic substance
GO:0051172	0.887	negative regulation of nitrogen compound metabolic process
GO:0051253	0.876	negative regulation of RNA metabolic process
GO:0010558	0.873	negative regulation of macromolecule biosynthetic process
GO:0031327	0.872	negative regulation of cellular biosynthetic process
GO:0045892	0.842	negative regulation of DNA-templated transcription
GO:0048518	0.730	positive regulation of biological process
GO:0000122	0.707	negative regulation of transcription by RNA polymerase II
GO:0048522	0.554	positive regulation of cellular process
GO:0010604	0.503	positive regulation of macromolecule metabolic process
GO:0051173	0.465	positive regulation of nitrogen compound metabolic process
GO:0031325	0.465	positive regulation of cellular metabolic process
GO:0071310	0.441	cellular response to organic substance
GO:0045935	0.349	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.338	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0032991	0.989	protein-containing complex
GO:0005730	0.937	nucleolus
GO:0005737	0.616	cytoplasm
GO:0005667	0.315	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]