StarFunc result for job id Q04206

User Input

>input (551 residues)
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q04206	1.000	1.000	7.903E-95	551	1.000	1.000	Q04206.pdb.gz	TF65_HUMAN Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=2
2	AFDB:Q04207	0.613	0.615	4.253E-85	549	0.889	0.893	Q04207.pdb.gz	TF65_MOUSE Transcription factor p65 OS=Mus musculus OX=10090 GN=Rela PE=1 SV=1
3	AFDB:B3DHW2	0.507	0.612	4.365E-54	455	0.443	0.536	B3DHW2.pdb.gz	B3DHW2_DANRE Transcription factor p65 OS=Danio rerio OX=7955 GN=nfkb3 PE=1 SV=1
4	AFDB:P16236	0.532	0.491	2.673E-51	598	0.436	0.401	P16236.pdb.gz	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
5	AFDB:Q6DGE6	0.524	0.485	2.980E-51	596	0.425	0.393	Q6DGE6.pdb.gz	Q6DGE6_DANRE Proto-oncogene c-Rel OS=Danio rerio OX=7955 GN=c-rel PE=1 SV=1
6	AFDB:Q04864	0.528	0.472	8.375E-51	619	0.419	0.373	Q04864.pdb.gz	REL_HUMAN Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1
7	AFDB:P15307	0.530	0.498	1.022E-49	587	0.407	0.382	P15307.pdb.gz	REL_MOUSE Proto-oncogene c-Rel OS=Mus musculus OX=10090 GN=Rel PE=1 SV=2
8	AFDB:P19838	0.486	0.282	1.018E-37	968	0.283	0.161	P19838.pdb.gz	NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens OX=9606 GN=NFKB1 PE=1 SV=2
9	AFDB:Q04861	0.486	0.278	1.851E-37	983	0.267	0.150	Q04861.pdb.gz	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
10	AFDB:P25799	0.487	0.281	2.064E-37	971	0.279	0.159	P25799.pdb.gz	NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus OX=10090 GN=Nfkb1 PE=1 SV=2
11	PDB:6kzbC	0.222	0.197	4.628E-5	649	0.049	0.042	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
12	PDB:7tvzE	0.184	0.162	4.887E-5	665	0.040	0.033	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
13	PDB:1f13A	0.218	0.178	7.550E-5	722	0.049	0.037	1f13A.pdb.gz
14	PDB:2q3zA	0.196	0.173	1.105E-4	655	0.047	0.040	2q3zA.pdb.gz	Transglutaminase 2 undergoes a large conformational change upon activation
15	PDB:3s3sA	0.200	0.182	1.617E-4	620	0.040	0.035	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease
16	PDB:4pygA	0.212	0.183	2.010E-4	685	0.054	0.044	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
17	PDB:1l9mB	0.199	0.171	2.638E-4	681	0.054	0.044	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
18	PDB:5ghuA	0.157	0.300	3.105E-4	201	0.058	0.159	5ghuA.pdb.gz
19	PDB:7u7nC	0.179	0.344	3.655E-4	200	0.047	0.130	7u7nC.pdb.gz
20	PDB:4nenA	0.166	0.101	5.349E-4	1063	0.069	0.036	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X0W8	0.0	841	448	0.750	0.922	A0A087X0W8_HUMAN RELA proto-oncogene, NF-kB subunit OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
2	A0A8I5ZMV7	0.0	961	557	0.900	0.890	A0A8I5ZMV7_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
3	A0A8I6A5H5	0.0	962	550	0.900	0.902	A0A8I6A5H5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
4	A0A8I6ATQ5	0.0	880	544	0.848	0.858	A0A8I6ATQ5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
5	E9PKH5	0.0	827	418	0.739	0.974	E9PKH5_HUMAN RELA proto-oncogene, NF-kB subunit (Fragment) OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
6	F7F7J5	0.0	946	541	0.887	0.904	F7F7J5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
7	Q04206	0.0	1118	551	1.000	1.000	TF65_HUMAN Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=2
8	Q04207	0.0	964	549	0.886	0.889	TF65_MOUSE Transcription factor p65 OS=Mus musculus OX=10090 GN=Rela PE=1 SV=1
9	Q2TAM5	0.0	716	377	0.624	0.912	Q2TAM5_HUMAN RELA protein OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
10	Q7TQN4	0.0	965	550	0.904	0.905	Q7TQN4_RAT Nuclear factor kappaB subunit p65 OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
11	Q96CP1	1.65e-167	476	246	0.410	0.919	Q96CP1_HUMAN RELA protein OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
12	E9PQS6	2.96e-152	436	208	0.374	0.990	E9PQS6_HUMAN RELA proto-oncogene, NF-kB subunit (Fragment) OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
13	B3DHW2	1.32e-151	444	455	0.396	0.479	B3DHW2_DANRE Transcription factor p65 OS=Danio rerio OX=7955 GN=nfkb3 PE=1 SV=1
14	E9PI38	5.16e-136	394	185	0.336	1.000	E9PI38_HUMAN RELA proto-oncogene, NF-kB subunit (Fragment) OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
15	Q6DGE6	2.42e-135	407	596	0.352	0.326	Q6DGE6_DANRE Proto-oncogene c-Rel OS=Danio rerio OX=7955 GN=c-rel PE=1 SV=1
16	P16236	2.21e-132	400	598	0.347	0.319	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
17	F1M5R1	1.65e-131	397	566	0.428	0.417	F1M5R1_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=3
18	A0A8I6ABJ7	1.29e-129	392	595	0.345	0.319	A0A8I6ABJ7_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=1
19	A0A8I5XW27	1.38e-129	392	585	0.345	0.325	A0A8I5XW27_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=1
20	Q04864	2.58e-128	390	619	0.347	0.309	REL_HUMAN Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04449 Fimbrial_CS1	5.8e+02	12.0	CS1 type fimbrial major subunit
2	PF16179 RHD_dimer	3.8e-33	124.9	Rel homology dimerisation domain
3	PF00554 RHD_DNA_bind	5.2e-66	233.3	Rel homology DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384273

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216797	0.999	NF-kappa-B inhibitor alpha
2	9606.ENSP00000226574	0.999	Nuclear factor NF-kappa-B p105 subunit
3	9606.ENSP00000262367	0.999	CREB-binding protein
4	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
5	9606.ENSP00000263377	0.999	Bromodomain-containing protein 4
6	9606.ENSP00000287820	0.999	Peroxisome proliferator-activated receptor gamma
7	9606.ENSP00000312988	0.999	NF-kappa-B inhibitor beta
8	9606.ENSP00000430432	0.999	Histone deacetylase 2
9	9606.ENSP00000212015	0.998	NAD-dependent protein deacetylase sirtuin-1
10	9606.ENSP00000275015	0.998	NF-kappa-B inhibitor epsilon
11	9606.ENSP00000359424	0.998	Inhibitor of nuclear factor kappa-B kinase subunit alpha
12	9606.ENSP00000361359	0.998	Tumor necrosis factor receptor superfamily member 5
13	9606.ENSP00000362649	0.998	Histone deacetylase 1
14	9606.ENSP00000430684	0.998	Inhibitor of nuclear factor kappa-B kinase subunit beta
15	9606.ENSP00000264657	0.997	Signal transducer and activator of transcription 3
16	9606.ENSP00000329357	0.997	Transcription factor Sp1
17	9606.ENSP00000302967	0.995	Histone deacetylase 3
18	9606.ENSP00000337332	0.994	NAD-dependent protein deacetylase sirtuin-6
19	9606.ENSP00000231509	0.992	Glucocorticoid receptor
20	9606.ENSP00000306512	0.991	Interleukin-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0043565	0.998	sequence-specific DNA binding
GO:0003690	0.998	double-stranded DNA binding
GO:0140110	0.990	transcription regulator activity
GO:0003700	0.984	DNA-binding transcription factor activity
GO:1990837	0.977	sequence-specific double-stranded DNA binding
GO:0000978	0.969	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000981	0.944	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0019899	0.915	enzyme binding
GO:0042802	0.906	identical protein binding
GO:0001228	0.831	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0044877	0.744	protein-containing complex binding
GO:0019901	0.641	protein kinase binding
GO:0008092	0.479	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.993	cellular response to stimulus
GO:0010033	0.990	response to organic substance
GO:1901700	0.989	response to oxygen-containing compound
GO:1900076	0.989	regulation of cellular response to insulin stimulus
GO:0071704	0.987	organic substance metabolic process
GO:0009605	0.987	response to external stimulus
GO:0023051	0.985	regulation of signaling
GO:0010646	0.985	regulation of cell communication
GO:0048522	0.985	positive regulation of cellular process
GO:0048519	0.978	negative regulation of biological process
GO:0044237	0.978	cellular metabolic process
GO:1901652	0.977	response to peptide
GO:0071222	0.976	cellular response to lipopolysaccharide
GO:0009719	0.972	response to endogenous stimulus
GO:0046683	0.970	response to organophosphorus
GO:0034612	0.970	response to tumor necrosis factor
GO:0045685	0.970	regulation of glial cell differentiation
GO:0014013	0.970	regulation of gliogenesis
GO:0046627	0.970	negative regulation of insulin receptor signaling pathway
GO:0043279	0.969	response to alkaloid
GO:0002931	0.964	response to ischemia
GO:0006081	0.963	cellular aldehyde metabolic process
GO:0014072	0.963	response to isoquinoline alkaloid
GO:0032502	0.958	developmental process
GO:0045597	0.950	positive regulation of cell differentiation
GO:0033273	0.944	response to vitamin
GO:0043278	0.942	response to morphine
GO:0032570	0.939	response to progesterone
GO:0051591	0.937	response to cAMP
GO:0014015	0.936	positive regulation of gliogenesis
GO:0071345	0.933	cellular response to cytokine stimulus
GO:0019222	0.932	regulation of metabolic process
GO:0043200	0.919	response to amino acid
GO:0071356	0.919	cellular response to tumor necrosis factor
GO:0007568	0.915	aging
GO:0000302	0.896	response to reactive oxygen species
GO:0060255	0.865	regulation of macromolecule metabolic process
GO:0010604	0.857	positive regulation of macromolecule metabolic process
GO:0080090	0.853	regulation of primary metabolic process
GO:0051171	0.852	regulation of nitrogen compound metabolic process
GO:0031323	0.845	regulation of cellular metabolic process
GO:0010468	0.843	regulation of gene expression
GO:0042542	0.842	response to hydrogen peroxide
GO:0045687	0.828	positive regulation of glial cell differentiation
GO:0051173	0.824	positive regulation of nitrogen compound metabolic process
GO:0019219	0.820	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.817	regulation of cellular biosynthetic process
GO:0043434	0.813	response to peptide hormone
GO:0009628	0.795	response to abiotic stimulus
GO:0010556	0.771	regulation of macromolecule biosynthetic process
GO:0051252	0.770	regulation of RNA metabolic process
GO:0006355	0.764	regulation of DNA-templated transcription
GO:0032868	0.751	response to insulin
GO:0031325	0.731	positive regulation of cellular metabolic process
GO:0009612	0.711	response to mechanical stimulus
GO:0009410	0.710	response to xenobiotic stimulus
GO:0048584	0.664	positive regulation of response to stimulus
GO:0045935	0.644	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.642	positive regulation of cellular biosynthetic process
GO:0006357	0.636	regulation of transcription by RNA polymerase II
GO:0010605	0.635	negative regulation of macromolecule metabolic process
GO:0010557	0.635	positive regulation of macromolecule biosynthetic process
GO:0051254	0.623	positive regulation of RNA metabolic process
GO:0045893	0.607	positive regulation of DNA-templated transcription
GO:1902531	0.592	regulation of intracellular signal transduction
GO:0007154	0.567	cell communication
GO:0023052	0.560	signaling
GO:0010941	0.520	regulation of cell death
GO:0009967	0.517	positive regulation of signal transduction
GO:0006807	0.516	nitrogen compound metabolic process
GO:0044238	0.514	primary metabolic process
GO:0043067	0.513	regulation of programmed cell death
GO:0007165	0.498	signal transduction
GO:0080134	0.492	regulation of response to stress
GO:0065009	0.482	regulation of molecular function
GO:0010628	0.444	positive regulation of gene expression
GO:0043170	0.426	macromolecule metabolic process
GO:0042981	0.421	regulation of apoptotic process
GO:0044093	0.418	positive regulation of molecular function
GO:0045944	0.418	positive regulation of transcription by RNA polymerase II
GO:0031324	0.409	negative regulation of cellular metabolic process
GO:1902533	0.405	positive regulation of intracellular signal transduction
GO:0051172	0.360	negative regulation of nitrogen compound metabolic process
GO:0002682	0.345	regulation of immune system process
GO:1901564	0.339	organonitrogen compound metabolic process
GO:0001817	0.328	regulation of cytokine production
GO:0007166	0.327	cell surface receptor signaling pathway
GO:0032101	0.314	regulation of response to external stimulus
GO:0002376	0.313	immune system process
GO:0032501	0.310	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.999	nucleus
GO:0032991	0.998	protein-containing complex
GO:0005654	0.959	nucleoplasm
GO:0043232	0.928	intracellular non-membrane-bounded organelle
GO:0030054	0.888	cell junction
GO:0045202	0.864	synapse
GO:0000785	0.442	chromatin
GO:0071159	0.385	NF-kappaB complex
GO:0035525	0.384	NF-kappaB p50/p65 complex
GO:0005667	0.351	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]