StarFunc result for job id Q04323

User Input

>input (297 residues)
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q499N6	0.725	0.725	7.074E-44	297	0.926	0.926	Q499N6.pdb.gz	UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ubxn1 PE=3 SV=2
2	AFDB:A0A024R539	0.486	0.467	4.411E-41	312	0.949	0.904	A0A024R539.pdb.gz
3	AFDB:A0A087WTZ5	0.414	0.483	1.032E-34	238	0.801	1.000	A0A087WTZ5.pdb.gz	A0A087WTZ5_HUMAN UBX domain protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=1
4	AFDB:Q9VSC5	0.430	0.396	1.500E-20	331	0.401	0.360	Q9VSC5.pdb.gz	Q9VSC5_DROME GM09977p OS=Drosophila melanogaster OX=7227 GN=anon-WO0172774.138 PE=1 SV=1
5	AFDB:Q9TXH9	0.312	0.310	2.609E-15	299	0.296	0.294	Q9TXH9.pdb.gz	UBXN1_CAEEL UBX domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=ubxn-1 PE=1 SV=1
6	AFDB:Q9Y114	0.314	0.154	2.669E-12	656	0.273	0.123	Q9Y114.pdb.gz	Q9Y114_DROME BcDNA.GH10229 OS=Drosophila melanogaster OX=7227 GN=anon-WO0172774.24 PE=1 SV=1
7	AFDB:P34631	0.256	0.165	9.662E-11	469	0.209	0.132	P34631.pdb.gz	UBXN4_CAEEL UBX domain-containing protein 4 OS=Caenorhabditis elegans OX=6239 GN=ubxn-4 PE=1 SV=1
8	AFDB:P47049	0.258	0.198	1.148E-9	396	0.118	0.088	P47049.pdb.gz	UBX6_YEAST UBX domain-containing protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBX6 PE=1 SV=1
9	AFDB:Q92575	0.255	0.156	1.221E-9	508	0.242	0.142	Q92575.pdb.gz	UBXN4_HUMAN UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2
10	AFDB:P38349	0.278	0.192	7.818E-9	436	0.155	0.106	P38349.pdb.gz	UBX7_YEAST UBX domain-containing protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBX7 PE=1 SV=1
11	PDB:6hd0D	0.225	0.799	9.231E-6	75	0.057	0.227	6hd0D.pdb.gz	Common Mode of Remodeling AAA ATPases p97/CDC48 by Their Disassembling Cofactors ASPL/PUX1.
12	PDB:5itdA	0.236	0.076	6.285E-5	995	0.057	0.017	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
13	PDB:4x57B	0.229	0.649	9.693E-5	93	0.054	0.172	4x57B.pdb.gz
14	PDB:7lq1A	0.240	0.082	1.031E-4	950	0.047	0.015	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
15	PDB:5dxhD	0.238	0.079	1.241E-4	981	0.051	0.015	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
16	PDB:3dbhI	0.224	0.682	1.495E-4	86	0.037	0.128	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
17	PDB:7rbsB	0.224	0.402	4.023E-4	157	0.057	0.108	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
18	PDB:4yknA	0.241	0.065	5.482E-4	1205	0.061	0.015	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
19	PDB:3ai5A	0.206	0.205	8.453E-4	299	0.037	0.037	3ai5A.pdb.gz
20	PDB:6pyuA	0.237	0.082	8.453E-4	930	0.047	0.015	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PJ81	0.0	562	290	0.976	1.000	E9PJ81_HUMAN UBX domain protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=1
2	E9PRQ7	0.0	565	293	0.987	1.000	E9PRQ7_HUMAN UBX domain protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=1
3	Q04323	0.0	578	297	1.000	1.000	UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2
4	Q499N6	4.09e-170	474	297	0.926	0.926	UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ubxn1 PE=3 SV=2
5	A0A087WTZ5	6.62e-136	385	238	0.673	0.840	A0A087WTZ5_HUMAN UBX domain protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=1
6	Q9VSC5	2.00e-52	176	331	0.418	0.375	Q9VSC5_DROME GM09977p OS=Drosophila melanogaster OX=7227 GN=anon-WO0172774.138 PE=1 SV=1
7	Q8SYN6	1.14e-51	174	330	0.414	0.373	Q8SYN6_DROME RE50471p OS=Drosophila melanogaster OX=7227 GN=CG8209 PE=2 SV=1
8	E9PS08	5.95e-44	147	100	0.253	0.750	E9PS08_HUMAN UBX domain protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=1
9	Q9TXH9	1.21e-27	110	299	0.310	0.308	UBXN1_CAEEL UBX domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=ubxn-1 PE=1 SV=1
10	Q9Y114	1.43e-26	111	656	0.259	0.117	Q9Y114_DROME BcDNA.GH10229 OS=Drosophila melanogaster OX=7227 GN=anon-WO0172774.24 PE=1 SV=1
11	Q92575	2.29e-16	81.3	508	0.185	0.108	UBXN4_HUMAN UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2
12	Q9MAT3	2.12e-14	75.1	413	0.236	0.169	Q9MAT3_ARATH F13M7.16 protein OS=Arabidopsis thaliana OX=3702 GN=At1g04850 PE=1 SV=1
13	P34631	1.06e-13	73.2	469	0.195	0.124	UBXN4_CAEEL UBX domain-containing protein 4 OS=Caenorhabditis elegans OX=6239 GN=ubxn-4 PE=1 SV=1
14	Q8BGG7	1.67e-11	67.0	638	0.104	0.049	UBS3B_MOUSE Ubiquitin-associated and SH3 domain-containing protein B OS=Mus musculus OX=10090 GN=Ubash3b PE=1 SV=1
15	Q8TF42	1.79e-11	66.6	649	0.104	0.048	UBS3B_HUMAN Ubiquitin-associated and SH3 domain-containing protein B OS=Homo sapiens OX=9606 GN=UBASH3B PE=1 SV=2
16	Q9VCE9	2.73e-11	66.2	751	0.108	0.043	EPP_DROME Ecdysteroid-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Epp PE=1 SV=1
17	P45974	1.85e-10	63.9	858	0.091	0.031	UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2
18	P56399	1.86e-10	63.9	858	0.091	0.031	UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus OX=10090 GN=Usp5 PE=1 SV=1
19	Q4V973	1.15e-09	61.2	834	0.088	0.031	Q4V973_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fc21h02 PE=1 SV=1
20	Q1MT86	1.16e-09	61.2	853	0.088	0.030	Q1MT86_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fa06b05 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00627 UBA	1.4e-05	36.2	UBA/TS-N domain
2	PF00789 UBX	2.8e-20	83.6	UBX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000002946

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000006492	0.996	Valosin containing protein
2	60711.ENSCSAP00000006842	0.957	NSFL1 (p97) cofactor (p47)
3	60711.ENSCSAP00000006774	0.956	UBX domain protein 6
4	60711.ENSCSAP00000004560	0.942	UBX domain protein 2A
5	60711.ENSCSAP00000004856	0.919	UBX domain protein 7
6	60711.ENSCSAP00000011908	0.904	UBX domain protein 8
7	60711.ENSCSAP00000003631	0.884	Tumor necrosis factor, alpha-induced protein 1 (endothelial)
8	60711.ENSCSAP00000000014	0.852	annotation not available
9	60711.ENSCSAP00000006509	0.852	Spermatogenesis associated 5-like 1
10	60711.ENSCSAP00000014414	0.852	annotation not available
11	60711.ENSCSAP00000001498	0.846	Small VCP/p97-interacting protein
12	60711.ENSCSAP00000012396	0.845	UBX domain protein 4
13	60711.ENSCSAP00000005993	0.822	Phospholipase A2-activating protein
14	60711.ENSCSAP00000001464	0.821	Autocrine motility factor receptor, E3 ubiquitin protein ligase
15	60711.ENSCSAP00000005601	0.787	Fas associated factor family member 2
16	60711.ENSCSAP00000010663	0.787	UBX domain protein 2B
17	60711.ENSCSAP00000006896	0.757	Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome
18	60711.ENSCSAP00000015861	0.740	ASPSCR1, UBX domain containing tether for SLC2A4
19	60711.ENSCSAP00000007888	0.734	Ubiquitin fusion degradation 1 like (yeast)
20	60711.ENSCSAP00000009126	0.734	Mitochondrial antiviral signaling protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140030	0.327	modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048583	0.991	regulation of response to stimulus
GO:0048523	0.991	negative regulation of cellular process
GO:0031329	0.988	regulation of cellular catabolic process
GO:0061136	0.985	regulation of proteasomal protein catabolic process
GO:0080134	0.981	regulation of response to stress
GO:1903320	0.973	regulation of protein modification by small protein conjugation or removal
GO:0009892	0.967	negative regulation of metabolic process
GO:0042177	0.964	negative regulation of protein catabolic process
GO:0044092	0.963	negative regulation of molecular function
GO:0031330	0.963	negative regulation of cellular catabolic process
GO:0045861	0.963	negative regulation of proteolysis
GO:2000058	0.960	regulation of ubiquitin-dependent protein catabolic process
GO:0032434	0.954	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:1903051	0.953	negative regulation of proteolysis involved in protein catabolic process
GO:0080135	0.941	regulation of cellular response to stress
GO:0048585	0.934	negative regulation of response to stimulus
GO:0031400	0.934	negative regulation of protein modification process
GO:0031396	0.923	regulation of protein ubiquitination
GO:2000059	0.919	negative regulation of ubiquitin-dependent protein catabolic process
GO:1905897	0.915	regulation of response to endoplasmic reticulum stress
GO:1901799	0.900	negative regulation of proteasomal protein catabolic process
GO:1903321	0.885	negative regulation of protein modification by small protein conjugation or removal
GO:0032435	0.871	negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0031397	0.867	negative regulation of protein ubiquitination
GO:0043086	0.846	negative regulation of catalytic activity
GO:0009987	0.825	cellular process
GO:1903573	0.769	negative regulation of response to endoplasmic reticulum stress
GO:0052547	0.541	regulation of peptidase activity
GO:0071704	0.520	organic substance metabolic process
GO:0051346	0.517	negative regulation of hydrolase activity
GO:0044237	0.496	cellular metabolic process
GO:0043170	0.451	macromolecule metabolic process
GO:0044238	0.408	primary metabolic process
GO:0006807	0.390	nitrogen compound metabolic process
GO:0010466	0.368	negative regulation of peptidase activity
GO:0048518	0.363	positive regulation of biological process
GO:0050896	0.346	response to stimulus
GO:1901564	0.305	organonitrogen compound metabolic process
GO:0044260	0.301	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.996	nucleoplasm
GO:0016020	0.702	membrane
GO:0012505	0.479	endomembrane system
GO:0032991	0.407	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]