StarFunc result for job id Q04446

User Input

>input (702 residues)
MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIG
ENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYG
KWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDP
EHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAI
MEHAYYASFGYQITSFFAASSRYGTPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEILRFLLSNIRWWLEEYRFDGFRFDGVT
SMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPAL
CSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESH
DQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAP
QAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGH
QRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5cltA	0.914	0.993	0.000	646	0.915	0.994	5cltA.pdb.gz	Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose
2	AFDB:A0A0G2JTB2	0.930	0.997	0.000	655	0.822	0.881	A0A0G2JTB2.pdb.gz	A0A0G2JTB2_RAT 1,4-alpha-glucan branching enzyme OS=Rattus norvegicus OX=10116 GN=Gbe1 PE=1 SV=2
3	AFDB:A1Z992	0.953	0.976	0.000	685	0.593	0.607	A1Z992.pdb.gz	A1Z992_DROME 1,4-alpha-glucan branching enzyme OS=Drosophila melanogaster OX=7227 GN=AGBE PE=1 SV=1
4	AFDB:Q04446	1.000	1.000	0.000	702	1.000	1.000	Q04446.pdb.gz	GLGB_HUMAN 1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3
5	AFDB:Q6FJV0	0.949	0.944	3.427E-103	706	0.581	0.578	Q6FJV0.pdb.gz	GLGB_CANGA 1,4-alpha-glucan-branching enzyme OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLC3 PE=1 SV=1
6	AFDB:P32775	0.946	0.944	2.353E-100	704	0.577	0.575	P32775.pdb.gz	GLGB_YEAST 1,4-alpha-glucan-branching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLC3 PE=1 SV=2
7	AFDB:Q9LZS3	0.938	0.819	2.856E-99	805	0.548	0.478	Q9LZS3.pdb.gz	GLGB2_ARATH 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SBE2.2 PE=1 SV=1
8	AFDB:Q41058	0.942	0.718	1.481E-98	922	0.550	0.419	Q41058.pdb.gz	GLGB1_PEA 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic OS=Pisum sativum OX=3888 GN=SBEI PE=1 SV=1
9	AFDB:O23647	0.944	0.773	3.987E-97	858	0.557	0.456	O23647.pdb.gz	GLGB1_ARATH 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SBE2.1 PE=1 SV=1
10	PDB:7p44B	0.937	0.939	1.213E-92	700	0.575	0.577	7p44B.pdb.gz
11	AFDB:D2WL32	0.911	0.715	3.017E-74	899	0.396	0.309	D2WL32.pdb.gz	GLGB3_ARATH 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SBE3 PE=1 SV=1
12	AFDB:P30539	0.759	0.830	6.332E-46	639	0.242	0.266	P30539.pdb.gz	GLGB_BUTFI 1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens OX=831 GN=glgB PE=1 SV=1
13	PDB:3k1dA	0.735	0.716	1.329E-41	722	0.236	0.230	3k1dA.pdb.gz
14	PDB:2wskA	0.627	0.669	1.085E-22	654	0.157	0.168	2wskA.pdb.gz
15	PDB:1j0hA	0.485	0.570	4.966E-21	588	0.150	0.179	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
16	PDB:1ea9C	0.477	0.565	8.009E-21	583	0.128	0.154	1ea9C.pdb.gz
17	PDB:7vt9A	0.454	0.518	1.646E-16	604	0.123	0.142	7vt9A.pdb.gz
18	PDB:5jy7B	0.464	0.559	1.831E-16	571	0.140	0.172	5jy7B.pdb.gz	Crystal structure of the TreS-Pep2 complex, initiating alpha-glucan synthesis in the GlgE pathway of mycobacteria.
19	PDB:3a47A	0.467	0.547	1.351E-14	586	0.128	0.154	3a47A.pdb.gz	Crystal structure of isomaltase from Saccharomyces cerevisiae
20	PDB:3k8kA	0.448	0.480	1.762E-14	650	0.125	0.135	3k8kA.pdb.gz	SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MJY6	0.0	1210	648	0.815	0.883	A0A096MJY6_RAT 1,4-alpha-glucan branching enzyme OS=Rattus norvegicus OX=10116 GN=Gbe1 PE=1 SV=2
2	A0A0G2JTB2	0.0	1226	676	0.822	0.854	A0A0G2JTB2_RAT 1,4-alpha-glucan branching enzyme OS=Rattus norvegicus OX=10116 GN=Gbe1 PE=1 SV=2
3	A1Z992	0.0	883	685	0.595	0.610	A1Z992_DROME 1,4-alpha-glucan branching enzyme OS=Drosophila melanogaster OX=7227 GN=AGBE PE=1 SV=1
4	O23647	0.0	814	858	0.556	0.455	GLGB1_ARATH 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SBE2.1 PE=1 SV=1
5	P32775	0.0	786	704	0.581	0.580	GLGB_YEAST 1,4-alpha-glucan-branching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLC3 PE=1 SV=2
6	Q04446	0.0	1463	702	1.000	1.000	GLGB_HUMAN 1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3
7	Q41058	0.0	815	922	0.551	0.420	GLGB1_PEA 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic OS=Pisum sativum OX=3888 GN=SBEI PE=1 SV=1
8	Q5EB55	0.0	1055	536	0.711	0.931	Q5EB55_RAT Gbe1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Gbe1 PE=2 SV=1
9	Q6FJV0	0.0	806	706	0.583	0.579	GLGB_CANGA 1,4-alpha-glucan-branching enzyme OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLC3 PE=1 SV=1
10	Q8T0H4	0.0	676	463	0.453	0.687	Q8T0H4_DROME LD03583p OS=Drosophila melanogaster OX=7227 GN=AGBE PE=2 SV=1
11	Q9D6Y9	0.0	1336	702	0.902	0.902	GLGB_MOUSE 1,4-alpha-glucan-branching enzyme OS=Mus musculus OX=10090 GN=Gbe1 PE=1 SV=1
12	Q9LZS3	0.0	812	805	0.558	0.487	GLGB2_ARATH 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SBE2.2 PE=1 SV=1
13	D2WL32	1.89e-156	477	899	0.350	0.274	GLGB3_ARATH 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=SBE3 PE=1 SV=1
14	P9WN45	3.79e-48	183	731	0.262	0.252	GLGB_MYCTU 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgB PE=1 SV=1
15	P30539	6.93e-48	181	639	0.235	0.258	GLGB_BUTFI 1,4-alpha-glucan branching enzyme GlgB OS=Butyrivibrio fibrisolvens OX=831 GN=glgB PE=1 SV=1
16	P07762	7.23e-44	171	728	0.246	0.238	GLGB_ECOLI 1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli (strain K12) OX=83333 GN=glgB PE=1 SV=1
17	O04196	1.89e-11	69.7	783	0.094	0.084	ISOA1_ARATH Isoamylase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISA1 PE=1 SV=1
18	O22637	3.61e-11	68.9	789	0.080	0.071	SU1_MAIZE Isoamylase SU1, chloroplastic OS=Zea mays OX=4577 GN=SU1 PE=1 SV=1
19	D0TZF0	9.59e-10	64.3	803	0.075	0.066	ISOA1_ORYSJ Isoamylase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ISA1 PE=1 SV=1
20	Q9M0S5	1.26e-09	63.9	764	0.070	0.064	ISOA3_ARATH Isoamylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISA3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00128 Alpha-amylase	1.2e-10	53.1	Alpha amylase, catalytic domain
2	PF02806 Alpha-amylase_C	4.3e-22	89.7	Alpha amylase, C-terminal all-beta domain
3	PF02922 CBM_48	4.1e-15	67.2	Carbohydrate-binding module 48 (Isoamylase N-terminal domain)
4	PF18952 DUF5696	5.8e+02	10.4	Family of unknown function (DUF5696)
5	PF14701 hDGE_amylase	51	14.4	Glycogen debranching enzyme, glucanotransferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410833

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317904	0.999	Glycogen [starch] synthase, muscle
2	9606.ENSP00000294724	0.998	Glycogen debranching enzyme
3	9606.ENSP00000261195	0.997	Glycogen [starch] synthase, liver
4	9606.ENSP00000216392	0.994	Glycogen phosphorylase, liver form
5	9606.ENSP00000340736	0.994	Glycogenin-1
6	9606.ENSP00000164139	0.992	Glycogen phosphorylase, muscle form
7	9606.ENSP00000216962	0.992	Glycogen phosphorylase, brain form
8	9606.ENSP00000370555	0.969	Glycogenin-2
9	9606.ENSP00000354610	0.948	Amylase, alpha 2B
10	9606.ENSP00000447431	0.947	Probable maltase-glucoamylase 2
11	9606.ENSP00000447378	0.943	Maltase-glucoamylase, intestinal
12	9606.ENSP00000481450	0.942	Pancreatic alpha-amylase
13	9606.ENSP00000360124	0.932	Phosphoglucomutase-1
14	9606.ENSP00000330484	0.927	Belongs to the glycosyl hydrolase 13 family
15	9606.ENSP00000379678	0.901	Phosphoglucomutase-like protein 5
16	9606.ENSP00000338703	0.877	UTP--glucose-1-phosphate uridylyltransferase
17	9606.ENSP00000263182	0.814	Gamma-butyrobetaine dioxygenase
18	9606.ENSP00000362298	0.808	Sphingosine-1-phosphate lyase 1
19	9606.ENSP00000262030	0.770	ATP synthase subunit beta, mitochondrial
20	9606.ENSP00000473348	0.749	GDH/6PGL endoplasmic bifunctional protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003844	1.000	1,4-alpha-glucan branching enzyme activity
GO:0005488	0.999	binding
GO:0005515	0.989	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006091	0.996	generation of precursor metabolites and energy
GO:0033692	0.994	cellular polysaccharide biosynthetic process
GO:0005977	0.987	glycogen metabolic process
GO:0005978	0.983	glycogen biosynthetic process
GO:0065007	0.369	biological regulation
GO:0050789	0.362	regulation of biological process
GO:0050794	0.335	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.976	cytosol
GO:0043227	0.808	membrane-bounded organelle
GO:0043231	0.619	intracellular membrane-bounded organelle
GO:0070062	0.330	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.18	1.000	1,4-alpha-glucan branching enzyme.

[back to server]