StarFunc result for job id Q04637

User Input

>input (1599 residues)
MNKAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQHFYPSRAQPPS
SAASRVQSAAPARPGPAAHVYPAGSQVMMIPSQISYPASQGAYYIPGQGRSTYVVPTQQY
PVQPGAPGFYPGASPTEFGTYAGAYYPAQGVQQFPTGVAPTPVLMNQPPQIAPKRERKTI
RIRDPNQGGKDITEEIMSGARTASTPTPPQTGGGLEPQANGETPQVAVIVRPDDRSQGAI
IADRPGLPGPEHSPSESQPSSPSPTPSPSPVLEPGSEPNLAVLSIPGDTMTTIQMSVEES
TPISRETGEPYRLSPEPTPLAEPILEVEVTLSKPVPESEFSSSPLQAPTPLASHTVEIHE
PNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAVDLSPVSE
PEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGG
EELLPPESTPIPANLSQNLEAAAATQVAVSVPKRRRKIKELNKKEAVGDLLDAFKEANPA
VPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQ
WKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLRPLDPTRLQGI
NCGPDFTPSFANLGRTTLSTRGPPRGGPGGELPRGPAGLGPRRSQQGPRKEPRKIIATVL
MTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTPQMFQQLM
KQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKPTVTVNFR
KLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARRRSLGNIK
FIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFN
QMEKIIKEKKTSSRIRFMLQDVLDLRGSNWVPRRGDQGPKTIDQIHKEAEMEEHREHIKV
QQLMAKGSDKRRGGPPGPPISRGLPLVDDGGWNTVPISKGSRPIDTSRLTKITKPGSIDS
NNQLFAPGGRLSWGKGSSGGSGAKPSDAASEAARPATSTLNRFSALQQAVPTESTDNRRV
VQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEVEERSRERPSQ
PEGLRKAASLTEDRDRGRDAVKREAALPPVSPLKAALSEEELEKKSKAIIEEYLHLNDMK
EAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQLLHQLLCAGHLSTAQYYQGLY
EILELAEDMEIDIPHVWLYLAELVTPILQEGGVPMGELFREITKPLRPLGKAASLLLEIL
GLLCKSMGPKKVGTLWREAGLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAPGQRALPS
EELNRQLEKLLKEGSSNQRVFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIFETPLRVD
VAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAF
YSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43432	0.222	0.223	3.811E-81	1585	0.488	0.492	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
2	AFDB:Q80XI3	0.225	0.227	4.426E-78	1579	0.493	0.499	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
3	AFDB:C9JF13	0.172	0.283	6.428E-70	903	0.563	0.998	C9JF13.pdb.gz	C9JF13_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
4	AFDB:C9K073	0.093	0.161	8.009E-62	869	0.537	0.988	C9K073.pdb.gz	C9K073_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
5	AFDB:A8DZ29	0.163	0.138	1.492E-38	1919	0.247	0.206	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
6	AFDB:Q76E23	0.154	0.143	2.337E-29	1727	0.225	0.208	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
7	AFDB:Q10475	0.150	0.169	5.137E-15	1403	0.156	0.178	Q10475.pdb.gz	IF4G_SCHPO Eukaryotic translation initiation factor 4 gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif471 PE=1 SV=1
8	PDB:4jhjA	0.098	0.619	2.758E-4	216	0.029	0.218	4jhjA.pdb.gz	Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.
9	AFDB:Q8I3S3	0.050	0.047	4.344E-4	1894	0.084	0.071	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
10	AFDB:O64572	0.043	0.052	5.263E-4	1211	0.109	0.145	O64572.pdb.gz	O64572_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g19390 PE=1 SV=2
11	AFDB:Q9W517	0.081	0.077	8.025E-4	1741	0.151	0.138	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
12	PDB:5mqfT	0.109	0.400	1.185E-3	395	0.023	0.091	5mqfT.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
13	PDB:1h2uA	0.102	0.214	3.603E-3	706	0.054	0.123	1h2uA.pdb.gz	Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
14	PDB:7dvqV	0.109	0.343	5.494E-3	468	0.046	0.156	7dvqV.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:3feyA	0.107	0.209	1.379E-2	761	0.059	0.125	3feyA.pdb.gz
16	PDB:7f66J	0.084	0.214	1.608E-2	591	0.023	0.063	7f66J.pdb.gz
17	PDB:5gm6Z	0.108	0.345	2.858E-2	447	0.021	0.074	5gm6Z.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:5oobF	0.102	0.211	2.970E-2	718	0.054	0.121	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
19	PDB:7q2xD	0.082	0.111	5.487E-2	994	0.040	0.064	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
20	PDB:6yxxE6	0.069	0.156	9.033E-2	434	0.029	0.108	6yxxE6.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RU06	0.0	3232	1606	0.999	0.994	B2RU06_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
2	B2RU10	0.0	3234	1606	0.999	0.995	B2RU10_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
3	B4DGF1	0.0	3148	1566	0.972	0.993	B4DGF1_HUMAN cDNA FLJ56479, highly similar to Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 PE=2 SV=1
4	B4DSI9	0.0	3058	1512	0.943	0.997	B4DSI9_HUMAN cDNA FLJ56483, highly similar to Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 PE=2 SV=1
5	C9J2Z7	0.0	1665	833	0.520	0.999	C9J2Z7_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=8
6	C9J6B6	0.0	1515	757	0.473	1.000	C9J6B6_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
7	C9JF13	0.0	1639	903	0.563	0.997	C9JF13_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
8	C9K073	0.0	1718	869	0.538	0.991	C9K073_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
9	D3ZU13	0.0	2734	1598	0.910	0.911	D3ZU13_RAT Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=1
10	D4AD15	0.0	2737	1634	0.910	0.890	D4AD15_RAT Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=3
11	E7EUU4	0.0	3159	1560	0.975	0.999	E7EUU4_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
12	E7EX73	0.0	2899	1436	0.897	0.999	E7EX73_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
13	E9PGM1	0.0	3062	1513	0.946	0.999	E9PGM1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
14	M0RD03	0.0	2734	1641	0.910	0.887	M0RD03_RAT Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=2
15	O43432	0.0	1206	1585	0.503	0.507	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
16	Q04637	0.0	3242	1599	1.000	1.000	IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4
17	Q4LE58	0.0	3227	1624	0.999	0.983	Q4LE58_HUMAN eIF4G1 variant protein (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 variant protein PE=2 SV=1
18	Q6NZJ6	0.0	2753	1600	0.913	0.912	IF4G1_MOUSE Eukaryotic translation initiation factor 4 gamma 1 OS=Mus musculus OX=10090 GN=Eif4g1 PE=1 SV=1
19	Q80XI3	0.0	1134	1579	0.381	0.386	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
20	C9JWW9	4.13e-180	541	285	0.178	1.000	C9JWW9_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02847 MA3	1.4e-26	104.1	MA3 domain
2	PF02854 MIF4G	1.1e-65	232.8	MIF4G domain
3	PF02020 W2	2.2e-15	67.8	eIF4-gamma/eIF5/eIF2-epsilon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293831	0.999	Eukaryotic initiation factor 4A-I
2	9606.ENSP00000313007	0.999	Polyadenylate-binding protein 1
3	9606.ENSP00000326381	0.999	Eukaryotic initiation factor 4A-II
4	9606.ENSP00000361014	0.999	MAP kinase-interacting serine/threonine-protein kinase 1
5	9606.ENSP00000388806	0.999	Eukaryotic translation initiation factor 4B
6	9606.ENSP00000419449	0.999	Eukaryotic translation initiation factor 1
7	9606.ENSP00000425561	0.999	Eukaryotic translation initiation factor 4E
8	9606.ENSP00000220849	0.998	Eukaryotic translation initiation factor 3 subunit E
9	9606.ENSP00000313199	0.998	Heterogeneous nuclear ribonucleoprotein D0
10	9606.ENSP00000354125	0.998	Eukaryotic translation initiation factor 3 subunit B
11	9606.ENSP00000256383	0.997	Eukaryotic translation initiation factor 2 subunit 1
12	9606.ENSP00000358140	0.997	Eukaryotic translation initiation factor 3 subunit A
13	9606.ENSP00000364119	0.997	Eukaryotic translation initiation factor 2 subunit 2
14	9606.ENSP00000369757	0.996	40S ribosomal protein S6
15	9606.ENSP00000332604	0.995	Eukaryotic translation initiation factor 3 subunit C
16	9606.ENSP00000393324	0.995	Eukaryotic translation initiation factor 4E type 3
17	9606.ENSP00000382840	0.994	ATP-dependent RNA helicase DDX3X
18	9606.ENSP00000253039	0.993	Eukaryotic translation initiation factor 2 subunit 3
19	9606.ENSP00000340691	0.993	Eukaryotic translation initiation factor 4E-binding protein 1
20	9606.ENSP00000216554	0.992	Eukaryotic translation initiation factor 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008190	1.000	eukaryotic initiation factor 4E binding
GO:1901363	0.630	heterocyclic compound binding
GO:0097159	0.630	organic cyclic compound binding
GO:0003676	0.615	nucleic acid binding
GO:0003723	0.606	RNA binding
GO:0090079	0.460	translation regulator activity, nucleic acid binding
GO:0008135	0.449	translation factor activity, RNA binding
GO:0000339	0.402	RNA cap binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.968	response to stimulus
GO:0050789	0.932	regulation of biological process
GO:0050794	0.922	regulation of cellular process
GO:0032501	0.906	multicellular organismal process
GO:0009987	0.895	cellular process
GO:0071704	0.858	organic substance metabolic process
GO:0044238	0.852	primary metabolic process
GO:0060255	0.852	regulation of macromolecule metabolic process
GO:0080090	0.822	regulation of primary metabolic process
GO:0051171	0.822	regulation of nitrogen compound metabolic process
GO:0044237	0.819	cellular metabolic process
GO:0006807	0.811	nitrogen compound metabolic process
GO:0043170	0.806	macromolecule metabolic process
GO:0031323	0.788	regulation of cellular metabolic process
GO:0010468	0.784	regulation of gene expression
GO:0051246	0.659	regulation of protein metabolic process
GO:0031326	0.637	regulation of cellular biosynthetic process
GO:0010556	0.630	regulation of macromolecule biosynthetic process
GO:0042221	0.590	response to chemical
GO:0048518	0.584	positive regulation of biological process
GO:0010033	0.572	response to organic substance
GO:0048856	0.562	anatomical structure development
GO:0010608	0.545	post-transcriptional regulation of gene expression
GO:0006417	0.542	regulation of translation
GO:0034641	0.537	cellular nitrogen compound metabolic process
GO:0048522	0.457	positive regulation of cellular process
GO:0097305	0.442	response to alcohol
GO:0009893	0.420	positive regulation of metabolic process
GO:0010604	0.411	positive regulation of macromolecule metabolic process
GO:0044260	0.404	cellular macromolecule metabolic process
GO:0010467	0.400	gene expression
GO:0048519	0.393	negative regulation of biological process
GO:0009892	0.382	negative regulation of metabolic process
GO:0048523	0.364	negative regulation of cellular process
GO:0006412	0.362	translation
GO:0007275	0.357	multicellular organism development
GO:0010605	0.351	negative regulation of macromolecule metabolic process
GO:0045471	0.342	response to ethanol
GO:0051173	0.314	positive regulation of nitrogen compound metabolic process
GO:0031325	0.309	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005737	0.992	cytoplasm
GO:0005829	0.979	cytosol
GO:0031981	0.548	nuclear lumen
GO:0005654	0.499	nucleoplasm
GO:0032991	0.371	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]