StarFunc result for job id Q04656

User Input

>input (1500 residues)
MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPK
TLQEAIDDMGFDAVIHNPDPLPVLTDTLFLTVTASLTLPWDHIQSTLLKTKGVTDIKIYP
QKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGM
TCHSCTSTIEGKIGKLQGVQRIKVSLDNQEATIVYQPHLISVEEMKKQIEAMGFPAFVKK
QPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYTNDSTATFIIDGMHCKSCVSNIESTLS
ALQYVSSIVVSLENRSAIVKYNASSVTPESLRKAIEAVSPGLYRVSITSEVESTSNSPSS
SSLQKIPLNVVSQPLTQETVINIDGMTCNSCVQSIEGVISKKPGVKSIRVSLANSNGTVE
YDPLLTSPETLRGAIEDMGFDATLSDTNEPLVVIAQPSSEMPLLTSTNEFYTKGMTPVQD
KEEGKNSSKCYIQVTGMTCASCVANIERNLRREEGIYSILVALMAGKAEVRYNPAVIQPP
MIAEFIRELGFGATVIENADEGDGVLELVVRGMTCASCVHKIESSLTKHRGILYCSVALA
TNKAHIKYDPEIIGPRDIIHTIESLGFEASLVKKDRSASHLDHKREIRQWRRSFLVSLFF
CIPVMGLMIYMMVMDHHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNLLSFLLC
VPVQFFGGWYFYIQAYKALKHKTANMDVLIVLATTIAFAYSLIILLVAMYERAKVNPITF
FDTPPMLFVFIALGRWLEHIAKGKTSEALAKLISLQATEATIVTLDSDNILLSEEQVDVE
LVQRGDIIKVVPGGKFPVDGRVIEGHSMVDESLITGEAMPVAKKPGSTVIAGSINQNGSL
LICATHVGADTTLSQIVKLVEEAQTSKAPIQQFADKLSGYFVPFIVFVSIATLLVWIVIG
FLNFEIVETYFPGYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGA
QNGILIKGGEPLEMAHKVKVVVFDKTGTITHGTPVVNQVKVLTESNRISHHKILAIVGTA
ESNSEHPLGTAITKYCKQELDTETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDN
NIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVN
DFMTEHERKGRTAVLVAVDDELCGLIAIADTVKPEAELAIHILKSMGLEVVLMTGDNSKT
ARSIASQVGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGT
GTDVAIEAADVVLIRNDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAGVFMPI
GLVLQPWMGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGI
DDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A669KA36	0.289	0.388	0.000	1110	0.446	0.603	A0A669KA36.pdb.gz	A0A669KA36_HUMAN P-type Cu(+) transporter (Fragment) OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
2	AFDB:F1Q5B3	0.603	0.603	0.000	1500	0.654	0.654	F1Q5B3.pdb.gz
3	AFDB:G5EE14	0.626	0.751	0.000	1238	0.366	0.443	G5EE14.pdb.gz	G5EE14_CAEEL P-type Cu(+) transporter OS=Caenorhabditis elegans OX=6239 GN=cua-1 PE=1 SV=1
4	AFDB:P35670	0.609	0.624	0.000	1465	0.557	0.571	P35670.pdb.gz	ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=4
5	AFDB:P70705	0.677	0.681	0.000	1492	0.887	0.891	P70705.pdb.gz	ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp7a PE=1 SV=1
6	AFDB:Q04656	1.000	1.000	0.000	1500	1.000	1.000	Q04656.pdb.gz	ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP7A PE=1 SV=4
7	AFDB:Q64446	0.601	0.617	0.000	1462	0.553	0.568	Q64446.pdb.gz	ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp7b PE=1 SV=2
8	AFDB:Q9VYT4	0.597	0.709	0.000	1254	0.387	0.463	Q9VYT4.pdb.gz	Q9VYT4_DROME P-type Cu(+) transporter OS=Drosophila melanogaster OX=7227 GN=ATP7 PE=3 SV=3
9	AFDB:Q5B756	0.556	0.695	2.804E-97	1182	0.296	0.376	Q5B756.pdb.gz	Q5B756_EMENI Copper resistance P-type ATPase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03624 PE=3 SV=1
10	AFDB:Q4WQF3	0.503	0.628	1.437E-94	1187	0.294	0.372	Q4WQF3.pdb.gz	Q4WQF3_ASPFU Copper-transporting ATPase, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G12620 PE=3 SV=1
11	PDB:4bbjA	0.314	0.631	6.567E-52	664	0.177	0.401	4bbjA.pdb.gz	Copper-Transporting P-Type Atpases Use a Unique Ion-Release Pathway
12	PDB:3j09A	0.266	0.471	7.695E-44	723	0.206	0.427	3j09A.pdb.gz
13	PDB:7nnlB	0.309	0.608	3.477E-32	682	0.102	0.224	7nnlB.pdb.gz	Deciphering ion transport and ATPase coupling in the intersubunit tunnel of KdpFABC.
14	PDB:7e7sA	0.292	0.407	1.075E-29	1020	0.097	0.142	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
15	PDB:7vh5A	0.317	0.555	2.044E-29	804	0.085	0.159	7vh5A.pdb.gz
16	PDB:5zmwA	0.281	0.398	5.767E-27	1000	0.097	0.146	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
17	PDB:7x20A	0.252	0.365	8.964E-25	986	0.091	0.139	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
18	PDB:3ixzA	0.257	0.367	2.047E-24	998	0.083	0.125	3ixzA.pdb.gz
19	PDB:8d3xA	0.260	0.376	2.143E-24	989	0.088	0.133	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
20	PDB:3b8eA	0.248	0.355	3.066E-23	998	0.088	0.132	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A669KA36	813	1110	0.294	0.397	A0A669KA36_HUMAN P-type Cu(+) transporter (Fragment) OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
2	A0A669KB88	902	1387	0.312	0.337	A0A669KB88_HUMAN P-type Cu(+) transporter OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
3	B7ZLR4	1453	1417	0.525	0.555	B7ZLR4_HUMAN P-type Cu(+) transporter OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
4	E7ET55	1236	1381	0.471	0.512	E7ET55_HUMAN P-type Cu(+) transporter OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=3
5	F1QEG1	1934	1482	0.658	0.666	F1QEG1_DANRE P-type Cu(+) transporter OS=Danio rerio OX=7955 GN=cal PE=3 SV=2
6	F5H748	1333	1400	0.496	0.531	F5H748_HUMAN P-type Cu(+) transporter OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=1
7	G5ED40	904	1116	0.351	0.471	G5ED40_CAEEL P-type Cu(+) transporter OS=Caenorhabditis elegans OX=6239 GN=cua-1 PE=1 SV=1
8	G5EE14	925	1238	0.364	0.441	G5EE14_CAEEL P-type Cu(+) transporter OS=Caenorhabditis elegans OX=6239 GN=cua-1 PE=1 SV=1
9	P35670	1561	1465	0.549	0.562	ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP7B PE=1 SV=4
10	P70705	2670	1492	0.887	0.892	ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp7a PE=1 SV=1
11	Q04656	3088	1500	1.000	1.000	ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP7A PE=1 SV=4
12	Q4F8H5	1930	1482	0.657	0.665	Q4F8H5_DANRE P-type Cu(+) transporter OS=Danio rerio OX=7955 GN=zgc:153422 PE=2 SV=1
13	Q4WQF3	653	1187	0.293	0.371	Q4WQF3_ASPFU Copper-transporting ATPase, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G12620 PE=3 SV=1
14	Q54Q77	700	985	0.273	0.415	Q54Q77_DICDI P-type ATPase OS=Dictyostelium discoideum OX=44689 GN=atp7a PE=3 SV=1
15	Q5B756	603	1182	0.289	0.366	Q5B756_EMENI Copper resistance P-type ATPase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03624 PE=3 SV=1
16	Q64430	2693	1491	0.893	0.899	ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus OX=10090 GN=Atp7a PE=1 SV=3
17	Q64446	1564	1462	0.547	0.561	ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp7b PE=1 SV=2
18	Q64535	1547	1451	0.535	0.553	ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp7b PE=1 SV=1
19	Q9S7J8	632	1001	0.259	0.389	HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana OX=3702 GN=RAN1 PE=1 SV=1
20	Q9SH30	701	995	0.275	0.414	HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana OX=3702 GN=HMA5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19803 DUF6286	0.076	24.9	Family of unknown function (DUF6286)
2	PF00122 E1-E2_ATPase	1.1e-44	163.7	E1-E2 ATPase
3	PF13419 HAD_2	92	14.6	Haloacid dehalogenase-like hydrolase
4	PF00403 HMA	7.7e-89	303.4	Heavy-metal-associated domain
5	PF19991 HMA_2	0.35	22.2	Heavy metal associated domain 2
6	PF00702 Hydrolase	3.7e-60	215.3	haloacid dehalogenase-like hydrolase
7	PF08282 Hydrolase_3	0.0025	29.2	haloacid dehalogenase-like hydrolase
8	PF13344 Hydrolase_6	39	15.7	Haloacid dehalogenase-like hydrolase
9	PF08777 RRM_3	1.3	20.4	RNA binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345728

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430598	0.999	Copper transport protein ATOX1
2	9606.ENSP00000416255	0.987	Eukaryotic translation initiation factor 4 gamma 1
3	9606.ENSP00000371554	0.981	Extracellular superoxide dismutase [Cu-Zn]
4	9606.ENSP00000239666	0.963	Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10- binding protein TSPAN33
5	9606.ENSP00000369314	0.925	Glutaredoxin-1
6	9606.ENSP00000363329	0.887	High affinity copper uptake protein 1
7	9606.ENSP00000436318	0.874	Copper chaperone for superoxide dismutase
8	9606.ENSP00000264613	0.865	Ceruloplasmin
9	9606.ENSP00000261070	0.848	Cytochrome c oxidase copper chaperone
10	9606.ENSP00000259392	0.834	Probable low affinity copper uptake protein 2
11	9606.ENSP00000243911	0.832	Melanocortin receptor 3
12	9606.ENSP00000425561	0.828	Eukaryotic translation initiation factor 4E
13	9606.ENSP00000351777	0.824	Transitional endoplasmic reticulum ATPase
14	9606.ENSP00000242839	0.811	Copper-transporting ATPase 2
15	9606.ENSP00000308236	0.777	COMM domain-containing protein 1
16	9606.ENSP00000378364	0.739	Natural resistance-associated macrophage protein 2
17	9606.ENSP00000255390	0.733	Protein SCO1 homolog, mitochondrial
18	9606.ENSP00000384092	0.726	Pro-opiomelanocortin
19	9606.ENSP00000416508	0.726	Probable cation-transporting ATPase 13A3
20	9606.ENSP00000299335	0.714	Cytochrome c oxidase assembly protein COX11, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0015662	0.998	P-type ion transporter activity
GO:0005375	0.998	copper ion transmembrane transporter activity
GO:0019829	0.998	ATPase-coupled monoatomic cation transmembrane transporter activity
GO:0043167	0.977	ion binding
GO:0046914	0.966	transition metal ion binding
GO:0030554	0.964	adenyl nucleotide binding
GO:0035639	0.958	purine ribonucleoside triphosphate binding
GO:0005524	0.941	ATP binding
GO:0005507	0.884	copper ion binding
GO:1901702	0.830	salt transmembrane transporter activity
GO:1901682	0.814	sulfur compound transmembrane transporter activity
GO:0140104	0.623	molecular carrier activity
GO:0016530	0.527	metallochaperone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0065007	0.978	biological regulation
GO:0000041	0.940	transition metal ion transport
GO:0050896	0.873	response to stimulus
GO:0006825	0.841	copper ion transport
GO:0050789	0.788	regulation of biological process
GO:0050794	0.716	regulation of cellular process
GO:0042221	0.616	response to chemical
GO:0048518	0.474	positive regulation of biological process
GO:0019222	0.447	regulation of metabolic process
GO:0048522	0.427	positive regulation of cellular process
GO:0034220	0.420	monoatomic ion transmembrane transport
GO:0031323	0.405	regulation of cellular metabolic process
GO:0008152	0.403	metabolic process
GO:0010035	0.383	response to inorganic substance
GO:0046688	0.326	response to copper ion
GO:0071704	0.321	organic substance metabolic process
GO:0065009	0.317	regulation of molecular function
GO:0051716	0.306	cellular response to stimulus
GO:0098662	0.304	inorganic cation transmembrane transport
GO:0098655	0.304	monoatomic cation transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005886	0.989	plasma membrane
GO:0005794	0.988	Golgi apparatus
GO:0031410	0.987	cytoplasmic vesicle
GO:0031090	0.982	organelle membrane
GO:0005768	0.982	endosome
GO:0031984	0.968	organelle subcompartment
GO:0005802	0.959	trans-Golgi network
GO:0098588	0.920	bounding membrane of organelle
GO:0012506	0.745	vesicle membrane
GO:0098590	0.718	plasma membrane region
GO:0030659	0.718	cytoplasmic vesicle membrane
GO:0005576	0.595	extracellular region
GO:0048471	0.564	perinuclear region of cytoplasm
GO:0045178	0.530	basal part of cell
GO:0005770	0.518	late endosome
GO:0016323	0.505	basolateral plasma membrane
GO:0120025	0.451	plasma membrane bounded cell projection
GO:0032588	0.422	trans-Golgi network membrane
GO:0065010	0.421	extracellular membrane-bounded organelle
GO:0036477	0.360	somatodendritic compartment
GO:0043233	0.360	organelle lumen
GO:0043005	0.359	neuron projection
GO:0055037	0.352	recycling endosome
GO:0070013	0.345	intracellular organelle lumen
GO:0030669	0.341	clathrin-coated endocytic vesicle membrane
GO:0031981	0.329	nuclear lumen
GO:0005615	0.328	extracellular space
GO:0043025	0.321	neuronal cell body
GO:1903561	0.303	extracellular vesicle
GO:0099503	0.301	secretory vesicle
GO:0005654	0.301	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.998	Translocases.
RHEA:28703	0.998	Cu(2+)(in) = Cu(2+)(out)

[back to server]