StarFunc result for job id Q04695

User Input

>input (432 residues)
MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSC
YSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWY
QRQAPGPARDYSQYYRTIEELQNKILTATVDNANILLQIDNARLAADDFRTKFETEQALR
LSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVE
MDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI
SELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEM
EQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKV
ISSREQVHQTTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6IFU8	0.517	0.515	2.179E-50	433	0.956	0.954	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
2	AFDB:P02533	0.624	0.574	4.496E-40	472	0.792	0.725	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
3	AFDB:Q6PVZ1	0.471	0.439	5.858E-40	467	0.757	0.700	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
4	AFDB:Q6IFV1	0.612	0.551	6.773E-39	485	0.787	0.701	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
5	AFDB:P08779	0.519	0.479	8.810E-34	473	0.718	0.655	P08779.pdb.gz	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
6	AFDB:P19012	0.507	0.483	1.327E-32	456	0.648	0.614	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
7	AFDB:Q9Z2K1	0.642	0.596	2.253E-32	469	0.681	0.627	Q9Z2K1.pdb.gz	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
8	AFDB:Q61414	0.582	0.558	1.178E-31	452	0.632	0.604	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
9	AFDB:Q99456	0.480	0.424	5.464E-30	494	0.586	0.512	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
10	AFDB:Q6IFX1	0.442	0.395	2.342E-29	491	0.556	0.489	Q6IFX1.pdb.gz	K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus norvegicus OX=10116 GN=Krt24 PE=3 SV=1
11	PDB:6fhmA	0.065	0.121	7.469E-1	193	0.009	0.021	6fhmA.pdb.gz
12	PDB:5tthA	0.061	0.043	1.355	671	0.025	0.016	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
13	PDB:2ymwB	0.066	0.042	2.152	685	0.016	0.010	2ymwB.pdb.gz
14	PDB:3j9zSQ	0.057	0.199	2.457	83	0.016	0.084	3j9zSQ.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
15	PDB:4xo1A	0.063	0.298	2.625	60	0.023	0.167	4xo1A.pdb.gz
16	PDB:6hivBN	0.083	0.144	2.805	214	0.023	0.047	6hivBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:6xywBi	0.057	0.196	3.654	101	0.012	0.050	6xywBi.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
18	PDB:7kgbR	0.052	0.206	3.904	100	0.012	0.050	7kgbR.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
19	PDB:5ondA	0.046	0.129	4.171	135	0.009	0.030	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
20	PDB:7un6B	0.054	0.093	4.171	240	0.012	0.021	7un6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P02533	0.0	595	472	0.683	0.625	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
2	P08779	0.0	538	473	0.611	0.558	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
3	Q04695	0.0	875	432	1.000	1.000	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
4	Q61781	0.0	594	484	0.683	0.610	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
5	Q6IFU8	0.0	777	433	0.956	0.954	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
6	Q6IFV1	0.0	599	485	0.685	0.610	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
7	Q6PVZ1	0.0	598	467	0.750	0.694	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
8	Q9QWL7	0.0	776	433	0.954	0.952	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
9	Q9Z2K1	7.52e-177	504	469	0.567	0.522	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
10	P19001	1.75e-176	501	403	0.558	0.598	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
11	Q63279	1.62e-172	490	403	0.537	0.576	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
12	Q61414	1.75e-172	492	452	0.560	0.535	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
13	Q6IFV3	2.57e-172	492	447	0.560	0.541	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
14	P08727	1.09e-170	486	400	0.542	0.585	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
15	P19012	1.18e-170	488	456	0.560	0.531	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
16	K7ERE3	8.01e-168	479	415	0.537	0.559	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
17	P13646	1.00e-167	480	458	0.537	0.507	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
18	A1A4E9	4.98e-167	479	458	0.535	0.504	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
19	P08730	3.95e-165	473	437	0.537	0.531	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
20	Q6IFV4	1.84e-163	469	438	0.588	0.580	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	2.2e-114	393.8	Intermediate filament protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308452

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264255	0.956	Thioredoxin domain-containing protein 9
2	9606.ENSP00000301653	0.786	Keratin, type I cytoskeletal 16
3	9606.ENSP00000252242	0.783	Keratin, type II cytoskeletal 5
4	9606.ENSP00000167586	0.759	Keratin, type I cytoskeletal 14
5	9606.ENSP00000369317	0.748	Keratin, type II cytoskeletal 6A
6	9606.ENSP00000275493	0.722	Epidermal growth factor receptor
7	9606.ENSP00000291582	0.715	Autoimmune regulator
8	9606.ENSP00000340989	0.713	14-3-3 protein sigma
9	9606.ENSP00000343129	0.663	Tripartite motif-containing protein 29
10	9606.ENSP00000252252	0.650	Keratin, type II cytoskeletal 6B
11	9606.ENSP00000379566	0.644	Coiled-coil alpha-helical rod protein 1
12	9606.ENSP00000269571	0.609	Receptor tyrosine-protein kinase erbB-2
13	9606.ENSP00000007735	0.595	Keratin, type I cuticular Ha3-I
14	9606.ENSP00000325120	0.567	Progesterone receptor
15	9606.ENSP00000372221	0.563	Serpin B5
16	9606.ENSP00000264012	0.561	Cadherin-3
17	9606.ENSP00000251645	0.545	Keratin, type I cuticular Ha1
18	9606.ENSP00000251646	0.544	Keratin, type I cuticular Ha3-II
19	9606.ENSP00000329243	0.542	Keratin, type II cytoskeletal 7
20	9606.ENSP00000301656	0.537	Keratin, type I cytoskeletal 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.800	structural molecule activity
GO:0005200	0.597	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0032502	0.990	developmental process
GO:0045103	0.968	intermediate filament-based process
GO:0048856	0.913	anatomical structure development
GO:0065007	0.896	biological regulation
GO:0050789	0.857	regulation of biological process
GO:0050794	0.813	regulation of cellular process
GO:0071840	0.763	cellular component organization or biogenesis
GO:0016043	0.751	cellular component organization
GO:0007010	0.659	cytoskeleton organization
GO:0009888	0.581	tissue development
GO:0032501	0.445	multicellular organismal process
GO:0050896	0.436	response to stimulus
GO:0008544	0.420	epidermis development
GO:0019222	0.356	regulation of metabolic process
GO:0048518	0.349	positive regulation of biological process
GO:0060255	0.315	regulation of macromolecule metabolic process
GO:0051171	0.313	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005737	0.990	cytoplasm
GO:0005886	0.990	plasma membrane
GO:0005856	0.986	cytoskeleton
GO:0005829	0.972	cytosol
GO:0045111	0.969	intermediate filament cytoskeleton
GO:0099080	0.965	supramolecular complex
GO:0043227	0.962	membrane-bounded organelle
GO:0005576	0.954	extracellular region
GO:0099512	0.953	supramolecular fiber
GO:0005882	0.893	intermediate filament
GO:0031982	0.879	vesicle
GO:0005615	0.871	extracellular space
GO:0065010	0.859	extracellular membrane-bounded organelle
GO:1903561	0.825	extracellular vesicle
GO:0043231	0.818	intracellular membrane-bounded organelle
GO:0070062	0.788	extracellular exosome
GO:0045095	0.641	keratin filament
GO:0005634	0.548	nucleus
GO:0001533	0.414	cornified envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]