StarFunc result for job id Q04721

User Input

>input (2471 residues)
MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGS
FCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
KKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCAS
SPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAG
SKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNL
SVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPS
VSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHP
GIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMY
QIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPHNNMQVYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QZF2	0.161	0.161	0.000	2468	0.550	0.551	F1QZF2.pdb.gz
2	AFDB:F1RCH4	0.170	0.170	0.000	2475	0.555	0.554	F1RCH4.pdb.gz	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
3	AFDB:O35516	0.255	0.255	0.000	2473	0.925	0.924	O35516.pdb.gz	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
4	AFDB:P21783	0.182	0.179	0.000	2524	0.544	0.533	P21783.pdb.gz	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
5	AFDB:P31695	0.105	0.131	0.000	1964	0.327	0.411	P31695.pdb.gz	NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus OX=10090 GN=Notch4 PE=1 SV=3
6	AFDB:P46530	0.185	0.187	0.000	2437	0.529	0.536	P46530.pdb.gz	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
7	AFDB:Q9UM47	0.151	0.158	0.000	2321	0.486	0.517	Q9UM47.pdb.gz	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
8	AFDB:Q90Y57	0.056	0.092	9.763E-61	1242	0.133	0.265	Q90Y57.pdb.gz	JAG1A_DANRE Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1
9	AFDB:P0DPK4	0.067	0.419	5.295E-31	236	0.085	0.890	P0DPK4.pdb.gz	NT2NC_HUMAN Notch homolog 2 N-terminal-like protein C OS=Homo sapiens OX=9606 GN=NOTCH2NLC PE=1 SV=2
10	AFDB:O00548	0.047	0.131	9.623E-28	723	0.070	0.241	O00548.pdb.gz	DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2
11	PDB:8cs9A	0.088	0.257	4.262E-10	796	0.029	0.089	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:5vkqA	0.093	0.151	1.444E-8	1499	0.026	0.043	5vkqA.pdb.gz
13	PDB:2dvwA	0.070	0.726	9.550E-8	229	0.020	0.218	2dvwA.pdb.gz
14	PDB:4oauC	0.071	0.226	1.942E-6	692	0.028	0.101	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:6v9hC	0.069	0.589	3.075E-6	270	0.019	0.174	6v9hC.pdb.gz
16	PDB:6mwqA	0.053	0.253	9.454E-6	493	0.021	0.105	6mwqA.pdb.gz
17	PDB:7q3nU	0.039	0.196	1.422E-5	292	0.015	0.130	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
18	PDB:1wg0A	0.066	0.625	2.252E-5	243	0.019	0.198	1wg0A.pdb.gz
19	PDB:6jd6B	0.045	0.538	2.625E-5	192	0.016	0.203	6jd6B.pdb.gz
20	PDB:6aunA	0.065	0.213	3.388E-5	618	0.022	0.089	6aunA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0PGH6	2175	2465	0.486	0.487	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
2	A2RUV0	2538	2522	0.552	0.541	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
3	B8JI71	633	2904	0.174	0.148	EYS_DANRE Protein eyes shut homolog OS=Danio rerio OX=7955 GN=eys PE=1 SV=2
4	F1RCH4	2543	2475	0.559	0.558	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
5	G3I6Z6	2543	2527	0.545	0.533	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
6	O35516	4584	2473	0.926	0.925	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
7	P07207	1982	2703	0.420	0.384	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
8	P21783	2538	2524	0.547	0.536	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
9	P31695	818	1964	0.195	0.245	NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus OX=10090 GN=Notch4 PE=1 SV=3
10	P46530	2447	2437	0.528	0.535	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
11	P46531	2550	2555	0.550	0.532	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
12	Q01705	2547	2531	0.547	0.534	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
13	Q04721	5057	2471	1.000	1.000	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
14	Q07008	2547	2531	0.548	0.535	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
15	Q61982	1201	2318	0.272	0.290	NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1
16	Q800E4	2551	2468	0.553	0.553	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
17	Q99466	1076	2003	0.286	0.353	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
18	Q9QW30	4577	2471	0.921	0.921	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
19	Q9R172	1189	2319	0.271	0.289	NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus OX=10116 GN=Notch3 PE=2 SV=2
20	Q9UM47	1202	2321	0.272	0.290	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	4.9e-19	79.1	Ankyrin repeat
2	PF12796 Ank_2	3.5e-20	83.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.8e-11	54.0	Ankyrin repeat
4	PF13637 Ank_4	1e-10	53.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.3e-18	76.8	Ankyrin repeats (many copies)
6	PF12662 cEGF	29	16.0	Complement Clr-like EGF-like
7	PF00008 EGF	1.3e-215	708.1	EGF-like domain
8	PF07974 EGF_2	6.9e-21	85.6	EGF-like domain
9	PF12947 EGF_3	9.3e-06	37.0	EGF domain
10	PF07645 EGF_CA	8.4e-60	210.0	Calcium-binding EGF domain
11	PF12310 Elf-1_N	3.2e+02	13.4	Transcription factor protein N terminal
12	PF12661 hEGF	7.7e-132	437.3	Human growth factor-like EGF
13	PF06816 NOD	9.6e-22	87.4	NOTCH protein
14	PF07684 NODP	7.1e-15	66.1	NOTCH protein
15	PF00066 Notch	3.4e-21	86.7	LNR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256646

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345206	0.999	Recombining binding protein suppressor of hairless
2	9606.ENSP00000355718	0.985	Delta-like protein 1
3	9606.ENSP00000254958	0.984	Protein jagged-1
4	9606.ENSP00000326366	0.979	Presenilin-1
5	9606.ENSP00000222725	0.975	Beta-1,3-N-acetylglucosaminyltransferase lunatic fringe
6	9606.ENSP00000260408	0.973	Disintegrin and metalloproteinase domain-containing protein 10
7	9606.ENSP00000367714	0.971	Transcription factor HES-5
8	9606.ENSP00000292599	0.970	Mastermind-like protein 1
9	9606.ENSP00000349490	0.970	Beta-1,3-N-acetylglucosaminyltransferase manic fringe
10	9606.ENSP00000232424	0.968	Transcription factor HES-1
11	9606.ENSP00000385451	0.968	Midkine
12	9606.ENSP00000294785	0.967	Nicastrin
13	9606.ENSP00000355747	0.967	Presenilin-2
14	9606.ENSP00000364902	0.966	GDP-fucose protein O-fucosyltransferase 1
15	9606.ENSP00000328169	0.963	Protein jagged-2
16	9606.ENSP00000249749	0.955	Delta-like protein 4
17	9606.ENSP00000451300	0.954	Protein numb homolog
18	9606.ENSP00000307971	0.953	Beta-1,3-N-acetylglucosaminyltransferase radical fringe
19	9606.ENSP00000358795	0.953	E3 ubiquitin-protein ligase NEURL1
20	9606.ENSP00000295588	0.952	Protein O-glucosyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060089	0.998	molecular transducer activity
GO:0019899	0.984	enzyme binding
GO:0140297	0.840	DNA-binding transcription factor binding
GO:0038023	0.836	signaling receptor activity
GO:0061629	0.820	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0051059	0.790	NF-kappaB binding
GO:0140110	0.454	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0050896	0.995	response to stimulus
GO:0032501	0.989	multicellular organismal process
GO:0051716	0.988	cellular response to stimulus
GO:0048856	0.985	anatomical structure development
GO:0007219	0.966	Notch signaling pathway
GO:0048523	0.926	negative regulation of cellular process
GO:0007275	0.921	multicellular organism development
GO:0030154	0.918	cell differentiation
GO:0048731	0.872	system development
GO:0048518	0.870	positive regulation of biological process
GO:0048513	0.860	animal organ development
GO:0019222	0.859	regulation of metabolic process
GO:0060255	0.847	regulation of macromolecule metabolic process
GO:0080090	0.839	regulation of primary metabolic process
GO:0050793	0.832	regulation of developmental process
GO:0048522	0.827	positive regulation of cellular process
GO:0051171	0.808	regulation of nitrogen compound metabolic process
GO:0009653	0.769	anatomical structure morphogenesis
GO:0072359	0.759	circulatory system development
GO:0010468	0.757	regulation of gene expression
GO:0031323	0.756	regulation of cellular metabolic process
GO:0009966	0.727	regulation of signal transduction
GO:0048468	0.724	cell development
GO:0051239	0.702	regulation of multicellular organismal process
GO:0006950	0.676	response to stress
GO:0009888	0.646	tissue development
GO:0045595	0.646	regulation of cell differentiation
GO:0007399	0.630	nervous system development
GO:2000026	0.626	regulation of multicellular organismal development
GO:0010556	0.617	regulation of macromolecule biosynthetic process
GO:0031326	0.601	regulation of cellular biosynthetic process
GO:0009893	0.592	positive regulation of metabolic process
GO:0019219	0.592	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.556	positive regulation of macromolecule metabolic process
GO:0042127	0.538	regulation of cell population proliferation
GO:0048584	0.529	positive regulation of response to stimulus
GO:0030097	0.522	hemopoiesis
GO:0051252	0.522	regulation of RNA metabolic process
GO:0009967	0.499	positive regulation of signal transduction
GO:0006355	0.495	regulation of DNA-templated transcription
GO:0010605	0.481	negative regulation of macromolecule metabolic process
GO:0051173	0.456	positive regulation of nitrogen compound metabolic process
GO:0006357	0.451	regulation of transcription by RNA polymerase II
GO:0051172	0.429	negative regulation of nitrogen compound metabolic process
GO:0031324	0.428	negative regulation of cellular metabolic process
GO:0048589	0.402	developmental growth
GO:0001709	0.402	cell fate determination
GO:0048646	0.400	anatomical structure formation involved in morphogenesis
GO:0010558	0.395	negative regulation of macromolecule biosynthetic process
GO:0031325	0.394	positive regulation of cellular metabolic process
GO:0031327	0.394	negative regulation of cellular biosynthetic process
GO:0071840	0.363	cellular component organization or biogenesis
GO:0045892	0.348	negative regulation of DNA-templated transcription
GO:0009891	0.337	positive regulation of biosynthetic process
GO:0051254	0.335	positive regulation of RNA metabolic process
GO:0010557	0.325	positive regulation of macromolecule biosynthetic process
GO:0016043	0.316	cellular component organization
GO:0008284	0.308	positive regulation of cell population proliferation
GO:0009887	0.301	animal organ morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0005654	0.999	nucleoplasm
GO:0012505	0.997	endomembrane system
GO:0005576	0.995	extracellular region
GO:0005829	0.982	cytosol
GO:0032991	0.915	protein-containing complex
GO:0031090	0.878	organelle membrane
GO:0098588	0.764	bounding membrane of organelle
GO:0005794	0.644	Golgi apparatus
GO:0005783	0.594	endoplasmic reticulum
GO:0031984	0.456	organelle subcompartment
GO:0000139	0.441	Golgi membrane
GO:0009986	0.426	cell surface
GO:0098827	0.396	endoplasmic reticulum subcompartment
GO:0042175	0.353	nuclear outer membrane-endoplasmic reticulum membrane network

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]