StarFunc result for job id Q04724

User Input

>input (770 residues)
MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN
AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIK
DDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSD
GDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLK
SKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRT
PLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG
FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT
LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP
DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV
WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI
FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN
LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1N9Y3	0.483	0.482	0.000	773	0.868	0.864	F1N9Y3.pdb.gz
2	AFDB:Q04724	0.999	0.999	0.000	770	1.000	1.000	Q04724.pdb.gz	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
3	AFDB:H0YL70	0.464	0.457	2.928E-98	782	0.803	0.790	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
4	AFDB:O13166	0.453	0.458	1.174E-97	761	0.784	0.794	O13166.pdb.gz	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
5	AFDB:Q07141	0.465	0.478	1.363E-95	748	0.797	0.821	Q07141.pdb.gz	TLE4_RAT Transducin-like enhancer protein 4 OS=Rattus norvegicus OX=10116 GN=Tle4 PE=1 SV=2
6	AFDB:P16371	0.452	0.476	2.290E-83	730	0.612	0.645	P16371.pdb.gz	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
7	PDB:3jcmB	0.366	0.647	9.784E-24	429	0.078	0.140	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
8	PDB:5oa1V	0.370	0.986	5.702E-23	288	0.032	0.087	5oa1V.pdb.gz	Structural insights into transcription initiation by yeast RNA polymerase I.
9	PDB:5mzhB	0.351	0.623	1.414E-22	415	0.073	0.135	5mzhB.pdb.gz
10	PDB:7jvrB	0.368	0.800	1.836E-21	342	0.078	0.175	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
11	AFDB:O88466	0.322	0.136	7.992E-21	1888	0.148	0.060	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
12	PDB:7mqaLQ	0.347	0.322	1.475E-20	830	0.073	0.067	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:Q9H2Y7	0.329	0.139	3.205E-20	1883	0.151	0.062	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
14	PDB:5yzgs	0.362	0.724	5.913E-20	374	0.081	0.166	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:7bt6x	0.333	0.504	1.123E-19	488	0.092	0.145	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
16	PDB:6bk8D	0.352	0.729	1.632E-19	359	0.068	0.145	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:7mq8LU	0.353	0.601	1.721E-19	445	0.060	0.103	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:5nnzA	0.337	0.722	3.835E-19	335	0.070	0.161	5nnzA.pdb.gz
19	AFDB:O14306	0.323	0.214	6.543E-14	1191	0.126	0.081	O14306.pdb.gz	YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.10c PE=1 SV=2
20	AFDB:F1M754	0.285	0.194	3.615E-13	1178	0.173	0.113	F1M754.pdb.gz	F1M754_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YKN8	0.0	1203	778	0.804	0.796	H0YKN8_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
2	H0YKT5	0.0	1195	774	0.801	0.797	H0YKT5_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
3	H0YL70	0.0	1211	782	0.812	0.799	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
4	H0YNT2	0.0	1135	716	0.756	0.813	H0YNT2_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
5	K7EMK7	0.0	966	744	0.666	0.690	K7EMK7_HUMAN TLE family member 2, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=1
6	O13166	0.0	1182	761	0.800	0.809	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
7	O13168	0.0	1220	771	0.810	0.809	TLE3B_DANRE Transducin-like enhancer protein 3-B OS=Danio rerio OX=7955 GN=tle3b PE=1 SV=2
8	O42478	0.0	1288	772	0.855	0.852	TLE4_XENLA Transducin-like enhancer protein 4 OS=Xenopus laevis OX=8355 GN=tle4 PE=1 SV=2
9	P16371	0.0	660	730	0.399	0.421	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
10	Q04724	0.0	1595	770	1.000	1.000	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
11	Q04725	0.0	960	743	0.664	0.688	TLE2_HUMAN Transducin-like enhancer protein 2 OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=2
12	Q04726	0.0	1219	772	0.812	0.810	TLE3_HUMAN Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2
13	Q04727	0.0	1328	773	0.868	0.864	TLE4_HUMAN Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=3
14	Q07141	0.0	1174	748	0.800	0.824	TLE4_RAT Transducin-like enhancer protein 4 OS=Rattus norvegicus OX=10116 GN=Tle4 PE=1 SV=2
15	Q08122	0.0	1220	772	0.813	0.811	TLE3_MOUSE Transducin-like enhancer protein 3 OS=Mus musculus OX=10090 GN=Tle3 PE=1 SV=3
16	Q62440	0.0	1550	770	0.974	0.974	TLE1_MOUSE Transducin-like enhancer protein 1 OS=Mus musculus OX=10090 GN=Tle1 PE=1 SV=2
17	Q62441	0.0	1329	773	0.868	0.864	TLE4_MOUSE Transducin-like enhancer protein 4 OS=Mus musculus OX=10090 GN=Tle4 PE=1 SV=4
18	Q8JIM6	0.0	1326	773	0.868	0.864	Q8JIM6_CHICK Groucho-related gene 4 OS=Gallus gallus OX=9031 GN=Grg4 PE=2 SV=1
19	Q9JIT3	0.0	1224	764	0.810	0.817	TLE3_RAT Transducin-like enhancer protein 3 OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1
20	Q5JSY7	6.76e-147	434	322	0.300	0.717	Q5JSY7_HUMAN TLE family member 4, transcriptional corepressor (Fragment) OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00028	32.5	Anaphase-promoting complex subunit 4 WD40 domain
2	PF02239 Cytochrom_D1	2.2e+02	11.8	Cytochrome D1 heme domain
3	PF02183 HALZ	56	15.4	Homeobox associated leucine zipper
4	PF20426 NBCH_WD40	0.0025	28.3	Neurobeachin beta propeller domain
5	PF11715 Nup160	2.1e+02	12.1	Nucleoporin Nup120/160
6	PF01084 Ribosomal_S18	8.9e+02	11.4	Ribosomal protein S18
7	PF03920 TLE_N	6e-64	225.1	Groucho/TLE N-terminal Q-rich domain
8	PF00400 WD40	5.4e-13	60.4	WD domain, G-beta repeat
9	PF17005 WD40_like	63	14.4	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365682

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339004	0.996	Forkhead box protein G1
2	9606.ENSP00000265165	0.994	Lymphoid enhancer-binding factor 1
3	9606.ENSP00000232424	0.992	Transcription factor HES-1
4	9606.ENSP00000362649	0.987	Histone deacetylase 1
5	9606.ENSP00000344456	0.984	Catenin beta-1
6	9606.ENSP00000365720	0.984	Transducin-like enhancer protein 4
7	9606.ENSP00000290921	0.969	C-terminal-binding protein 1
8	9606.ENSP00000358404	0.968	Transcription factor 7-like 2
9	9606.ENSP00000452871	0.967	Transducin-like enhancer protein 3
10	9606.ENSP00000338796	0.961	Synovial sarcoma, X breakpoint 2
11	9606.ENSP00000355759	0.956	Poly [ADP-ribose] polymerase 1
12	9606.ENSP00000221561	0.949	Amino-terminal enhancer of split
13	9606.ENSP00000381382	0.943	Transcription factor 4
14	9606.ENSP00000479618	0.935	Myc proto-oncogene protein
15	9606.ENSP00000392466	0.932	LIM domain-binding protein 1
16	9606.ENSP00000405574	0.932	F-box-like/WD repeat-containing protein TBL1XR1
17	9606.ENSP00000217964	0.927	F-box-like/WD repeat-containing protein TBL1X
18	9606.ENSP00000227507	0.927	G1/S-specific cyclin-D1
19	9606.ENSP00000262367	0.925	CREB-binding protein
20	9606.ENSP00000357442	0.924	Pygopus homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.971	transcription regulator activity
GO:0008134	0.936	transcription factor binding
GO:0140297	0.909	DNA-binding transcription factor binding
GO:0003712	0.878	transcription coregulator activity
GO:0003714	0.811	transcription corepressor activity
GO:0042802	0.362	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.996	regulation of metabolic process
GO:0050794	0.988	regulation of cellular process
GO:0048519	0.987	negative regulation of biological process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0009987	0.976	cellular process
GO:0009892	0.967	negative regulation of metabolic process
GO:0031323	0.933	regulation of cellular metabolic process
GO:0080090	0.932	regulation of primary metabolic process
GO:0010605	0.924	negative regulation of macromolecule metabolic process
GO:0031326	0.918	regulation of cellular biosynthetic process
GO:0032502	0.915	developmental process
GO:0051171	0.910	regulation of nitrogen compound metabolic process
GO:0019219	0.894	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.891	regulation of macromolecule biosynthetic process
GO:0006357	0.878	regulation of transcription by RNA polymerase II
GO:0048856	0.859	anatomical structure development
GO:0048518	0.814	positive regulation of biological process
GO:0009893	0.800	positive regulation of metabolic process
GO:1903507	0.795	negative regulation of nucleic acid-templated transcription
GO:0010604	0.792	positive regulation of macromolecule metabolic process
GO:0045892	0.783	negative regulation of DNA-templated transcription
GO:0050896	0.766	response to stimulus
GO:0032501	0.571	multicellular organismal process
GO:0048522	0.543	positive regulation of cellular process
GO:0000122	0.499	negative regulation of transcription by RNA polymerase II
GO:0051716	0.478	cellular response to stimulus
GO:0007154	0.459	cell communication
GO:0023052	0.457	signaling
GO:0007165	0.451	signal transduction
GO:0048583	0.433	regulation of response to stimulus
GO:0007275	0.431	multicellular organism development
GO:0010646	0.422	regulation of cell communication
GO:0023051	0.407	regulation of signaling
GO:0009966	0.386	regulation of signal transduction
GO:0051173	0.349	positive regulation of nitrogen compound metabolic process
GO:0051254	0.337	positive regulation of RNA metabolic process
GO:0048513	0.310	animal organ development
GO:0045893	0.308	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.983	protein-containing complex
GO:0005667	0.726	transcription regulator complex
GO:0005737	0.667	cytoplasm
GO:0140513	0.621	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]