StarFunc result for job id Q04726

User Input

>input (772 residues)
MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELN
AIIGQQQLQAQHLSHATHGPPVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLTV
KDEKNHHELDHRERESSANNSVSPSESLRASEKHRGSADYSMEAKKRKAEEKDSLSRYDS
DGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARSLKKDAPTSPASVASSSSTPSSK
TKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPIGIMASALRTP
ISITSSYAAPFAMMSHHEMNGSLTSPGAYAGLHNIPPQMSAAAAAAAAAYGRSPMVSFGA
VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQI
NTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKL
LPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNI
AVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTS
QIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGK
DNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0YL70	0.496	0.490	0.000	782	1.000	0.987	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
2	AFDB:O13166	0.558	0.565	0.000	761	0.881	0.894	O13166.pdb.gz	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
3	AFDB:F1N9Y3	0.498	0.497	8.389E-101	773	0.829	0.828	F1N9Y3.pdb.gz
4	AFDB:Q04724	0.465	0.466	4.348E-100	770	0.801	0.803	Q04724.pdb.gz	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
5	AFDB:Q07141	0.462	0.476	1.126E-91	748	0.766	0.790	Q07141.pdb.gz	TLE4_RAT Transducin-like enhancer protein 4 OS=Rattus norvegicus OX=10116 GN=Tle4 PE=1 SV=2
6	AFDB:K7EMK7	0.451	0.466	1.716E-83	744	0.655	0.680	K7EMK7.pdb.gz	K7EMK7_HUMAN TLE family member 2, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=1
7	AFDB:P16371	0.566	0.596	2.711E-82	730	0.624	0.660	P16371.pdb.gz	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
8	PDB:3jcmB	0.365	0.647	1.029E-23	429	0.076	0.138	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
9	PDB:5oa1V	0.368	0.982	1.574E-23	288	0.031	0.083	5oa1V.pdb.gz	Structural insights into transcription initiation by yeast RNA polymerase I.
10	PDB:7jvrB	0.366	0.800	6.464E-22	342	0.075	0.170	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
11	PDB:5mzhB	0.350	0.624	1.159E-21	415	0.071	0.133	5mzhB.pdb.gz
12	AFDB:O88466	0.328	0.139	4.515E-21	1888	0.161	0.066	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
13	AFDB:Q9H2Y7	0.330	0.140	1.451E-20	1883	0.148	0.061	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
14	PDB:7mqaLQ	0.346	0.322	2.264E-20	830	0.078	0.072	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7bt6x	0.331	0.502	2.518E-20	488	0.087	0.137	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
16	PDB:7mq8LU	0.353	0.602	3.849E-20	445	0.070	0.121	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:5yzgs	0.361	0.725	8.093E-20	374	0.079	0.163	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:6bk8D	0.354	0.739	2.467E-19	359	0.063	0.136	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
19	PDB:5nnzA	0.341	0.738	3.050E-19	335	0.067	0.155	5nnzA.pdb.gz
20	AFDB:O14306	0.328	0.217	2.303E-14	1191	0.131	0.085	O14306.pdb.gz	YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.10c PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YKN8	0.0	1583	778	0.990	0.982	H0YKN8_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
2	H0YKT5	0.0	1565	774	0.984	0.982	H0YKT5_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
3	H0YL70	0.0	1594	782	1.000	0.987	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
4	H0YNT2	0.0	1482	716	0.927	1.000	H0YNT2_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
5	K7EMK7	0.0	952	744	0.658	0.683	K7EMK7_HUMAN TLE family member 2, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=1
6	O13166	0.0	1348	761	0.882	0.895	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
7	O13168	0.0	1422	771	0.912	0.913	TLE3B_DANRE Transducin-like enhancer protein 3-B OS=Danio rerio OX=7955 GN=tle3b PE=1 SV=2
8	O42478	0.0	1194	772	0.817	0.817	TLE4_XENLA Transducin-like enhancer protein 4 OS=Xenopus laevis OX=8355 GN=tle4 PE=1 SV=2
9	P16371	0.0	832	730	0.620	0.656	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
10	Q04724	0.0	1218	770	0.808	0.810	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
11	Q04725	0.0	946	743	0.655	0.681	TLE2_HUMAN Transducin-like enhancer protein 2 OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=2
12	Q04726	0.0	1603	772	1.000	1.000	TLE3_HUMAN Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2
13	Q04727	0.0	1229	773	0.829	0.828	TLE4_HUMAN Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=3
14	Q07141	0.0	1104	748	0.771	0.795	TLE4_RAT Transducin-like enhancer protein 4 OS=Rattus norvegicus OX=10116 GN=Tle4 PE=1 SV=2
15	Q08122	0.0	1589	772	0.990	0.990	TLE3_MOUSE Transducin-like enhancer protein 3 OS=Mus musculus OX=10090 GN=Tle3 PE=1 SV=3
16	Q62440	0.0	1192	770	0.802	0.804	TLE1_MOUSE Transducin-like enhancer protein 1 OS=Mus musculus OX=10090 GN=Tle1 PE=1 SV=2
17	Q62441	0.0	1233	773	0.830	0.829	TLE4_MOUSE Transducin-like enhancer protein 4 OS=Mus musculus OX=10090 GN=Tle4 PE=1 SV=4
18	Q8JIM6	0.0	1228	773	0.828	0.827	Q8JIM6_CHICK Groucho-related gene 4 OS=Gallus gallus OX=9031 GN=Grg4 PE=2 SV=1
19	Q9JIT3	0.0	1565	764	0.982	0.992	TLE3_RAT Transducin-like enhancer protein 3 OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1
20	O02482	1.52e-148	449	612	0.387	0.489	UNC37_CAEEL Transcription factor unc-37 OS=Caenorhabditis elegans OX=6239 GN=unc-37 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00059	31.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF02239 Cytochrom_D1	2e+02	11.9	Cytochrome D1 heme domain
3	PF02183 HALZ	15	17.2	Homeobox associated leucine zipper
4	PF20426 NBCH_WD40	0.0033	27.9	Neurobeachin beta propeller domain
5	PF13570 PQQ_3	9.9e+02	11.7	PQQ-like domain
6	PF01084 Ribosomal_S18	8.5e+02	11.5	Ribosomal protein S18
7	PF03920 TLE_N	3.3e-62	219.5	Groucho/TLE N-terminal Q-rich domain
8	PF00400 WD40	4.9e-13	60.5	WD domain, G-beta repeat
9	PF17005 WD40_like	10	17.0	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000452871

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.980	Histone deacetylase 1
2	9606.ENSP00000366347	0.977	Homeobox protein Nkx-2.2
3	9606.ENSP00000358404	0.976	Transcription factor 7-like 2
4	9606.ENSP00000250448	0.975	Hepatocyte nuclear factor 3-alpha
5	9606.ENSP00000344456	0.974	Catenin beta-1
6	9606.ENSP00000365682	0.967	Transducin-like enhancer protein 1
7	9606.ENSP00000365720	0.962	Transducin-like enhancer protein 4
8	9606.ENSP00000290921	0.961	C-terminal-binding protein 1
9	9606.ENSP00000381382	0.936	Transcription factor 4
10	9606.ENSP00000392466	0.936	LIM domain-binding protein 1
11	9606.ENSP00000357442	0.925	Pygopus homolog 2
12	9606.ENSP00000257430	0.912	Adenomatous polyposis coli protein
13	9606.ENSP00000359206	0.912	F-box/WD repeat-containing protein 1A
14	9606.ENSP00000272317	0.908	Ubiquitin-40S ribosomal protein S27a
15	9606.ENSP00000234739	0.907	B-cell CLL/lymphoma 9 protein
16	9606.ENSP00000335320	0.904	B-cell CLL/lymphoma 9-like protein
17	9606.ENSP00000386170	0.903	T-box transcription factor TBX20
18	9606.ENSP00000304697	0.900	Polyubiquitin-B
19	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
20	9606.ENSP00000441543	0.900	Polyubiquitin-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.855	transcription regulator activity
GO:0008134	0.837	transcription factor binding
GO:0140297	0.794	DNA-binding transcription factor binding
GO:0003712	0.765	transcription coregulator activity
GO:0003714	0.526	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0010468	0.992	regulation of gene expression
GO:0009987	0.982	cellular process
GO:0048519	0.978	negative regulation of biological process
GO:0009889	0.962	regulation of biosynthetic process
GO:0009892	0.948	negative regulation of metabolic process
GO:0080090	0.944	regulation of primary metabolic process
GO:0031326	0.930	regulation of cellular biosynthetic process
GO:0032502	0.883	developmental process
GO:0051171	0.837	regulation of nitrogen compound metabolic process
GO:0006355	0.829	regulation of DNA-templated transcription
GO:0048518	0.802	positive regulation of biological process
GO:0048856	0.795	anatomical structure development
GO:0048523	0.738	negative regulation of cellular process
GO:0009893	0.680	positive regulation of metabolic process
GO:0006357	0.650	regulation of transcription by RNA polymerase II
GO:0010604	0.645	positive regulation of macromolecule metabolic process
GO:0050896	0.623	response to stimulus
GO:0032501	0.556	multicellular organismal process
GO:0010605	0.516	negative regulation of macromolecule metabolic process
GO:0051716	0.498	cellular response to stimulus
GO:0007154	0.469	cell communication
GO:0023052	0.467	signaling
GO:0045892	0.450	negative regulation of DNA-templated transcription
GO:0048583	0.412	regulation of response to stimulus
GO:0010646	0.399	regulation of cell communication
GO:0023051	0.397	regulation of signaling
GO:0009966	0.394	regulation of signal transduction
GO:0007275	0.366	multicellular organism development
GO:0048522	0.340	positive regulation of cellular process
GO:0007165	0.328	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.770	protein-containing complex
GO:0005737	0.636	cytoplasm
GO:0005667	0.512	transcription regulator complex
GO:0090575	0.307	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]