StarFunc result for job id Q04727

User Input

>input (773 residues)
MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEK
TEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQV
TMAELNAIIGQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQS
HLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIA
ARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASIASSS
STPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSL
RTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQ
INTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCR
LLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN
IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFT
SQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTG
KDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1N9Y3	0.444	0.444	0.000	773	0.994	0.994	F1N9Y3.pdb.gz
2	AFDB:Q04724	0.454	0.455	0.000	770	0.864	0.868	Q04724.pdb.gz	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
3	AFDB:O13166	0.503	0.510	7.704E-100	761	0.792	0.804	O13166.pdb.gz	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
4	AFDB:P16371	0.478	0.506	7.219E-84	730	0.596	0.632	P16371.pdb.gz	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
5	PDB:3jcmB	0.351	0.624	9.907E-24	429	0.078	0.140	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
6	PDB:5oa1V	0.369	0.986	3.387E-23	288	0.031	0.083	5oa1V.pdb.gz	Structural insights into transcription initiation by yeast RNA polymerase I.
7	PDB:5mzhB	0.350	0.623	3.960E-22	415	0.074	0.137	5mzhB.pdb.gz
8	PDB:7jvrB	0.367	0.802	1.094E-21	342	0.076	0.173	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
9	PDB:7mqaLQ	0.345	0.322	5.153E-21	830	0.072	0.067	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	AFDB:Q9H2Y7	0.334	0.141	8.574E-21	1883	0.154	0.063	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
11	PDB:7bt6x	0.331	0.504	2.182E-20	488	0.088	0.139	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
12	AFDB:O88466	0.331	0.141	2.367E-20	1888	0.159	0.065	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
13	PDB:5yzgs	0.361	0.724	4.865E-20	374	0.080	0.166	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:5nnzA	0.339	0.735	1.273E-19	335	0.066	0.152	5nnzA.pdb.gz
15	PDB:7mq8LU	0.352	0.602	2.173E-19	445	0.070	0.121	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7ajtJP	0.335	0.549	3.333E-19	461	0.066	0.111	7ajtJP.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	AFDB:M9PBJ7	0.289	0.193	9.236E-13	1213	0.169	0.108	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
18	AFDB:P83510	0.295	0.182	7.013E-11	1323	0.177	0.104	P83510.pdb.gz	TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus OX=10090 GN=Tnik PE=1 SV=2
19	AFDB:F1LP90	0.286	0.175	8.685E-11	1336	0.172	0.100	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
20	AFDB:O60336	0.333	0.175	4.804E-10	1514	0.069	0.035	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	H0YKN8	1235	778	0.819	0.814	H0YKN8_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
2	H0YKT5	1245	774	0.819	0.818	H0YKT5_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
3	H0YL70	1249	782	0.828	0.818	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
4	H0YNT2	1154	716	0.768	0.830	H0YNT2_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
5	K7EMK7	972	744	0.666	0.692	K7EMK7_HUMAN TLE family member 2, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=1
6	O13166	1212	761	0.798	0.811	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
7	O13168	1258	771	0.818	0.820	TLE3B_DANRE Transducin-like enhancer protein 3-B OS=Danio rerio OX=7955 GN=tle3b PE=1 SV=2
8	O42478	1550	772	0.975	0.977	TLE4_XENLA Transducin-like enhancer protein 4 OS=Xenopus laevis OX=8355 GN=tle4 PE=1 SV=2
9	P16371	671	730	0.400	0.423	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
10	Q04724	1337	770	0.864	0.868	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
11	Q04725	973	743	0.666	0.693	TLE2_HUMAN Transducin-like enhancer protein 2 OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=2
12	Q04726	1253	772	0.828	0.829	TLE3_HUMAN Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2
13	Q04727	1602	773	1.000	1.000	TLE4_HUMAN Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=3
14	Q07141	1350	748	0.918	0.949	TLE4_RAT Transducin-like enhancer protein 4 OS=Rattus norvegicus OX=10116 GN=Tle4 PE=1 SV=2
15	Q08122	1250	772	0.827	0.828	TLE3_MOUSE Transducin-like enhancer protein 3 OS=Mus musculus OX=10090 GN=Tle3 PE=1 SV=3
16	Q5JSY7	553	322	0.383	0.919	Q5JSY7_HUMAN TLE family member 4, transcriptional corepressor (Fragment) OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=1
17	Q62440	1288	770	0.860	0.864	TLE1_MOUSE Transducin-like enhancer protein 1 OS=Mus musculus OX=10090 GN=Tle1 PE=1 SV=2
18	Q62441	1598	773	0.996	0.996	TLE4_MOUSE Transducin-like enhancer protein 4 OS=Mus musculus OX=10090 GN=Tle4 PE=1 SV=4
19	Q8JIM6	1593	773	0.994	0.994	Q8JIM6_CHICK Groucho-related gene 4 OS=Gallus gallus OX=9031 GN=Grg4 PE=2 SV=1
20	Q9JIT3	1259	764	0.825	0.835	TLE3_RAT Transducin-like enhancer protein 3 OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.0001	33.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF02239 Cytochrom_D1	1.4e+02	12.4	Cytochrome D1 heme domain
3	PF15578 DUF4662	3.3e+02	12.4	Domain of unknown function (DUF4662)
4	PF02183 HALZ	62	15.2	Homeobox associated leucine zipper
5	PF20426 NBCH_WD40	0.002	28.6	Neurobeachin beta propeller domain
6	PF13570 PQQ_3	5e+02	12.6	PQQ-like domain
7	PF03920 TLE_N	2.5e-63	223.1	Groucho/TLE N-terminal Q-rich domain
8	PF00400 WD40	5.7e-14	63.5	WD domain, G-beta repeat
9	PF17005 WD40_like	51	14.6	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000003962

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001444	0.941	Uncharacterized protein
2	60711.ENSCSAP00000017842	0.875	Forkhead box D3
3	60711.ENSCSAP00000017338	0.865	Hes family bHLH transcription factor 4
4	60711.ENSCSAP00000003952	0.856	Transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)
5	60711.ENSCSAP00000005131	0.852	Hes family bHLH transcription factor 1
6	60711.ENSCSAP00000012943	0.830	Catenin beta 1
7	60711.ENSCSAP00000011669	0.821	C-terminal binding protein 1
8	60711.ENSCSAP00000018906	0.800	Forkhead box G1
9	60711.ENSCSAP00000008170	0.776	Ring finger and WD repeat domain 2, E3 ubiquitin protein ligase
10	60711.ENSCSAP00000004080	0.771	Paired box 3
11	60711.ENSCSAP00000002789	0.754	Homeobox protein engrailed-like
12	60711.ENSCSAP00000012602	0.754	Homeobox protein engrailed-like
13	60711.ENSCSAP00000000840	0.752	C-terminal binding protein 2
14	60711.ENSCSAP00000009805	0.751	Transcription factor 7 (T-cell specific, HMG-box)
15	60711.ENSCSAP00000000331	0.750	Lymphoid enhancer-binding factor 1
16	60711.ENSCSAP00000012137	0.750	Transcription factor 7-like 1 (T-cell specific, HMG-box)
17	60711.ENSCSAP00000011772	0.740	Histone deacetylase 2
18	60711.ENSCSAP00000016053	0.740	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
19	60711.ENSCSAP00000016960	0.740	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
20	60711.ENSCSAP00000017750	0.740	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.890	transcription regulator activity
GO:0008134	0.802	transcription factor binding
GO:0003712	0.655	transcription coregulator activity
GO:0003714	0.586	transcription corepressor activity
GO:0042802	0.583	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.997	regulation of metabolic process
GO:0048856	0.995	anatomical structure development
GO:0031326	0.991	regulation of cellular biosynthetic process
GO:0009987	0.988	cellular process
GO:0010468	0.987	regulation of gene expression
GO:0009892	0.986	negative regulation of metabolic process
GO:0006355	0.977	regulation of DNA-templated transcription
GO:0009890	0.948	negative regulation of biosynthetic process
GO:0045934	0.948	negative regulation of nucleobase-containing compound metabolic process
GO:0032501	0.946	multicellular organismal process
GO:0009653	0.942	anatomical structure morphogenesis
GO:0051253	0.937	negative regulation of RNA metabolic process
GO:0007275	0.928	multicellular organism development
GO:0010558	0.914	negative regulation of macromolecule biosynthetic process
GO:0050896	0.900	response to stimulus
GO:0031327	0.894	negative regulation of cellular biosynthetic process
GO:0006357	0.884	regulation of transcription by RNA polymerase II
GO:0048518	0.879	positive regulation of biological process
GO:0010604	0.859	positive regulation of macromolecule metabolic process
GO:0010628	0.847	positive regulation of gene expression
GO:0045892	0.846	negative regulation of DNA-templated transcription
GO:0030154	0.835	cell differentiation
GO:0048731	0.810	system development
GO:0048513	0.791	animal organ development
GO:0051716	0.743	cellular response to stimulus
GO:0010629	0.713	negative regulation of gene expression
GO:0023052	0.696	signaling
GO:0007154	0.696	cell communication
GO:0009888	0.665	tissue development
GO:0048522	0.636	positive regulation of cellular process
GO:0009790	0.616	embryo development
GO:0000122	0.593	negative regulation of transcription by RNA polymerase II
GO:0007165	0.581	signal transduction
GO:0007399	0.526	nervous system development
GO:0051173	0.503	positive regulation of nitrogen compound metabolic process
GO:0031325	0.500	positive regulation of cellular metabolic process
GO:0051254	0.489	positive regulation of RNA metabolic process
GO:0009887	0.461	animal organ morphogenesis
GO:0042221	0.430	response to chemical
GO:0009966	0.425	regulation of signal transduction
GO:1903508	0.415	positive regulation of nucleic acid-templated transcription
GO:0045893	0.414	positive regulation of DNA-templated transcription
GO:0007166	0.390	cell surface receptor signaling pathway
GO:0010033	0.384	response to organic substance
GO:0070887	0.366	cellular response to chemical stimulus
GO:0045944	0.355	positive regulation of transcription by RNA polymerase II
GO:0051239	0.332	regulation of multicellular organismal process
GO:0048646	0.327	anatomical structure formation involved in morphogenesis
GO:0045165	0.323	cell fate commitment
GO:0071310	0.312	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0032991	0.983	protein-containing complex
GO:0005667	0.880	transcription regulator complex
GO:0005737	0.640	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]