StarFunc result for job id Q04759

User Input

>input (706 residues)
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLP
EPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R506	0.786	0.779	0.000	713	0.751	0.743	F1R506.pdb.gz	F1R506_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-239o15.1 PE=3 SV=3
2	AFDB:Q02111	0.723	0.722	0.000	707	0.946	0.945	Q02111.pdb.gz	KPCT_MOUSE Protein kinase C theta type OS=Mus musculus OX=10090 GN=Prkcq PE=1 SV=1
3	AFDB:P09215	0.740	0.774	7.028E-99	673	0.619	0.649	P09215.pdb.gz	KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus OX=10116 GN=Prkcd PE=1 SV=1
4	AFDB:Q7ZUC5	0.783	0.806	1.795E-98	684	0.612	0.632	Q7ZUC5.pdb.gz	Q7ZUC5_DANRE Protein kinase C delta type OS=Danio rerio OX=7955 GN=prkcd PE=1 SV=1
5	AFDB:A0A024R328	0.478	0.499	1.045E-96	676	0.625	0.652	A0A024R328.pdb.gz
6	AFDB:P34722	0.696	0.698	6.442E-80	704	0.470	0.472	P34722.pdb.gz	KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans OX=6239 GN=tpa-1 PE=1 SV=2
7	AFDB:L7RTI5	0.476	0.458	9.109E-73	737	0.421	0.403	L7RTI5.pdb.gz	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
8	AFDB:B8A467	0.485	0.466	1.001E-71	738	0.412	0.394	B8A467.pdb.gz	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
9	AFDB:P23298	0.476	0.492	1.111E-71	683	0.412	0.426	P23298.pdb.gz	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
10	AFDB:P13678	0.487	0.467	1.233E-71	739	0.424	0.405	P13678.pdb.gz	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
11	PDB:3pfqA	0.439	0.589	5.692E-36	523	0.330	0.446	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.410	0.708	1.273E-27	405	0.166	0.289	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:3c4wB	0.385	0.520	6.078E-27	519	0.161	0.220	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
14	PDB:4mk0A	0.413	0.459	1.078E-26	631	0.156	0.174	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:3pvuA	0.406	0.468	1.136E-26	609	0.153	0.177	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
16	PDB:5x3fB	0.372	0.735	1.815E-26	349	0.150	0.304	5x3fB.pdb.gz
17	PDB:6s9wA	0.358	0.598	2.356E-26	411	0.204	0.350	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
18	PDB:3nynA	0.408	0.514	4.885E-26	554	0.154	0.197	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
19	PDB:6pjxA	0.404	0.520	9.129E-26	543	0.154	0.201	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
20	PDB:4yhjA	0.391	0.543	1.013E-25	501	0.164	0.232	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B8A467	551	738	0.416	0.398	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
2	F1R506	1107	713	0.751	0.743	F1R506_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-239o15.1 PE=3 SV=3
3	H9G2Y7	572	763	0.435	0.402	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
4	L7RTI5	565	737	0.424	0.406	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
5	P09215	915	673	0.620	0.651	KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus OX=10116 GN=Prkcd PE=1 SV=1
6	P09216	562	737	0.421	0.403	KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus OX=10116 GN=Prkce PE=1 SV=1
7	P13678	563	739	0.426	0.407	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
8	P16054	566	737	0.422	0.404	KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus OX=10090 GN=Prkce PE=1 SV=1
9	P23298	542	683	0.409	0.423	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
10	P24723	539	683	0.407	0.420	KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens OX=9606 GN=PRKCH PE=1 SV=4
11	P28867	913	674	0.618	0.647	KPCD_MOUSE Protein kinase C delta type OS=Mus musculus OX=10090 GN=Prkcd PE=1 SV=3
12	P34722	650	704	0.467	0.469	KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans OX=6239 GN=tpa-1 PE=1 SV=2
13	P34885	572	707	0.435	0.434	KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=2
14	P83099	554	671	0.401	0.422	KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster OX=7227 GN=Pkcdelta PE=2 SV=3
15	Q02111	1415	707	0.948	0.946	KPCT_MOUSE Protein kinase C theta type OS=Mus musculus OX=10090 GN=Prkcq PE=1 SV=1
16	Q02156	565	737	0.424	0.406	KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=1 SV=1
17	Q04759	1479	706	1.000	1.000	KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens OX=9606 GN=PRKCQ PE=1 SV=3
18	Q05655	909	676	0.623	0.651	KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=2
19	Q64617	540	683	0.408	0.422	KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus OX=10116 GN=Prkch PE=1 SV=1
20	Q7ZUC5	904	684	0.616	0.636	Q7ZUC5_DANRE Protein kinase C delta type OS=Danio rerio OX=7955 GN=prkcd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.15	22.7	ABC1 atypical kinase-like domain
2	PF01636 APH	78	14.6	Phosphotransferase enzyme family
3	PF00130 C1_1	6.1e-27	104.6	Phorbol esters/diacylglycerol binding domain (C1 domain)
4	PF03107 C1_2	15	17.3	C1 domain
5	PF12330 Haspin_kinase	2.3e+02	12.1	Haspin like kinase domain
6	PF14531 Kinase-like	1.2	20.0	Kinase-like
7	PF00069 Pkinase	9.9e-60	213.7	Protein kinase domain
8	PF00433 Pkinase_C	2e-05	36.5	Protein kinase C terminal domain
9	PF17667 Pkinase_fungal	49	14.1	Fungal protein kinase
10	PF07714 PK_Tyr_Ser-Thr	5.8e-38	142.2	Protein tyrosine and serine/threonine kinase
11	PF08746 zf-RING-like	38	15.9	RING-like domain
12	PF16744 zf-RING_15	6	18.4	KIAA1045 RING finger
13	PF13901 zf-RING_9	0.48	21.9	Putative zinc-RING and/or ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263125

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380150	0.997	Caspase recruitment domain-containing protein 11
2	9606.ENSP00000324890	0.996	T-cell-specific surface glycoprotein CD28
3	9606.ENSP00000430684	0.988	Inhibitor of nuclear factor kappa-B kinase subunit beta
4	9606.ENSP00000472929	0.984	Proto-oncogene vav
5	9606.ENSP00000337825	0.982	Tyrosine-protein kinase Lck
6	9606.ENSP00000359424	0.973	Inhibitor of nuclear factor kappa-B kinase subunit alpha
7	9606.ENSP00000046794	0.969	Lymphocyte cytosolic protein 2
8	9606.ENSP00000358866	0.966	Filamin-A
9	9606.ENSP00000483825	0.960	NF-kappa-B essential modulator
10	9606.ENSP00000359612	0.954	B-cell lymphoma/leukemia 10
11	9606.ENSP00000344220	0.953	3-phosphoinositide-dependent protein kinase 1
12	9606.ENSP00000011653	0.952	T-cell surface glycoprotein CD4
13	9606.ENSP00000354782	0.952	T-cell surface glycoprotein CD3 zeta chain
14	9606.ENSP00000378845	0.948	Linker for activation of T cells
15	9606.ENSP00000339186	0.945	GRB2-related adapter protein 2
16	9606.ENSP00000348278	0.940	STE20/SPS1-related proline-alanine-rich protein kinase
17	9606.ENSP00000386559	0.940	T-cell surface glycoprotein CD8 alpha chain
18	9606.ENSP00000407586	0.940	GTPase HRas
19	9606.ENSP00000264972	0.939	Tyrosine-protein kinase ZAP-70
20	9606.ENSP00000256078	0.935	GTPase KRas

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.896	enzyme binding
GO:0019901	0.766	protein kinase binding
GO:0004697	0.581	protein kinase C activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.994	response to stimulus
GO:0023052	0.986	signaling
GO:0007154	0.984	cell communication
GO:0032501	0.978	multicellular organismal process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0044238	0.977	primary metabolic process
GO:0006793	0.969	phosphorus metabolic process
GO:0071704	0.965	organic substance metabolic process
GO:1901564	0.964	organonitrogen compound metabolic process
GO:0043170	0.963	macromolecule metabolic process
GO:0048518	0.951	positive regulation of biological process
GO:0051716	0.946	cellular response to stimulus
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0048583	0.935	regulation of response to stimulus
GO:0048522	0.926	positive regulation of cellular process
GO:0080090	0.918	regulation of primary metabolic process
GO:0031323	0.914	regulation of cellular metabolic process
GO:0007165	0.909	signal transduction
GO:0019538	0.904	protein metabolic process
GO:0051171	0.901	regulation of nitrogen compound metabolic process
GO:0036211	0.894	protein modification process
GO:0006796	0.888	phosphate-containing compound metabolic process
GO:0009893	0.885	positive regulation of metabolic process
GO:0030155	0.875	regulation of cell adhesion
GO:0051239	0.825	regulation of multicellular organismal process
GO:0010604	0.822	positive regulation of macromolecule metabolic process
GO:0065009	0.801	regulation of molecular function
GO:0016310	0.772	phosphorylation
GO:0051128	0.751	regulation of cellular component organization
GO:0010468	0.723	regulation of gene expression
GO:0002684	0.705	positive regulation of immune system process
GO:0050865	0.690	regulation of cell activation
GO:0002376	0.668	immune system process
GO:0009966	0.665	regulation of signal transduction
GO:0051173	0.654	positive regulation of nitrogen compound metabolic process
GO:0031325	0.651	positive regulation of cellular metabolic process
GO:0019219	0.631	regulation of nucleobase-containing compound metabolic process
GO:0033043	0.622	regulation of organelle organization
GO:0048519	0.615	negative regulation of biological process
GO:0006468	0.609	protein phosphorylation
GO:0048584	0.571	positive regulation of response to stimulus
GO:0006950	0.554	response to stress
GO:0048523	0.547	negative regulation of cellular process
GO:0032502	0.546	developmental process
GO:0042221	0.520	response to chemical
GO:0044093	0.505	positive regulation of molecular function
GO:0050776	0.504	regulation of immune response
GO:0010556	0.488	regulation of macromolecule biosynthetic process
GO:0048856	0.487	anatomical structure development
GO:0007166	0.485	cell surface receptor signaling pathway
GO:0031326	0.482	regulation of cellular biosynthetic process
GO:0051240	0.480	positive regulation of multicellular organismal process
GO:0051252	0.480	regulation of RNA metabolic process
GO:0006355	0.473	regulation of DNA-templated transcription
GO:0022407	0.463	regulation of cell-cell adhesion
GO:0070887	0.443	cellular response to chemical stimulus
GO:0051246	0.433	regulation of protein metabolic process
GO:0050790	0.431	regulation of catalytic activity
GO:1903037	0.424	regulation of leukocyte cell-cell adhesion
GO:1902531	0.412	regulation of intracellular signal transduction
GO:0050870	0.406	positive regulation of T cell activation
GO:0051090	0.400	regulation of DNA-binding transcription factor activity
GO:0010033	0.385	response to organic substance
GO:0070663	0.383	regulation of leukocyte proliferation
GO:0071840	0.375	cellular component organization or biogenesis
GO:0051091	0.371	positive regulation of DNA-binding transcription factor activity
GO:0070665	0.350	positive regulation of leukocyte proliferation
GO:0046649	0.348	lymphocyte activation
GO:0042129	0.346	regulation of T cell proliferation
GO:0042102	0.341	positive regulation of T cell proliferation
GO:0035556	0.339	intracellular signal transduction
GO:0046634	0.335	regulation of alpha-beta T cell activation
GO:0016043	0.333	cellular component organization
GO:0050778	0.325	positive regulation of immune response
GO:0031399	0.319	regulation of protein modification process
GO:0071310	0.313	cellular response to organic substance
GO:0019220	0.313	regulation of phosphate metabolic process
GO:0034110	0.306	regulation of homotypic cell-cell adhesion
GO:0002764	0.305	immune response-regulating signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0005829	0.977	cytosol
GO:0043226	0.967	organelle
GO:0043229	0.961	intracellular organelle
GO:0043227	0.922	membrane-bounded organelle
GO:0043231	0.888	intracellular membrane-bounded organelle
GO:0005634	0.493	nucleus
GO:0070013	0.305	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.13	0.581	protein kinase C.

[back to server]