StarFunc result for job id Q04771

User Input

>input (509 residues)
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
ADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P37172	0.781	0.781	6.359E-99	509	0.984	0.984	P37172.pdb.gz	ACVR1_MOUSE Activin receptor type-1 OS=Mus musculus OX=10090 GN=Acvr1 PE=1 SV=2
2	AFDB:Q90ZK6	0.688	0.694	1.865E-87	504	0.839	0.847	Q90ZK6.pdb.gz	ACVR1_CHICK Activin receptor type-1 OS=Gallus gallus OX=9031 GN=ACVR1 PE=2 SV=1
3	AFDB:O73736	0.674	0.678	1.330E-73	506	0.648	0.652	O73736.pdb.gz	O73736_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=acvr1 PE=2 SV=1
4	AFDB:A4FUX2	0.637	0.645	4.771E-70	503	0.585	0.592	A4FUX2.pdb.gz	A4FUX2_BOVIN receptor protein serine/threonine kinase OS=Bos taurus OX=9913 GN=ACVRL1 PE=2 SV=1
5	AFDB:F1QH44	0.656	0.664	2.292E-69	502	0.580	0.588	F1QH44.pdb.gz
6	AFDB:A0A0B4K7J3	0.692	0.611	1.604E-64	582	0.519	0.454	A0A0B4K7J3.pdb.gz	A0A0B4K7J3_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=3 SV=1
7	AFDB:P80203	0.598	0.603	7.288E-64	504	0.583	0.589	P80203.pdb.gz	ACVL1_RAT Serine/threonine-protein kinase receptor R3 OS=Rattus norvegicus OX=10116 GN=Acvrl1 PE=1 SV=2
8	AFDB:M0R3J4	0.637	0.646	1.207E-63	502	0.485	0.492	M0R3J4.pdb.gz	M0R3J4_RAT Serine/threonine-protein kinase receptor OS=Rattus norvegicus OX=10116 GN=Bmpr1b PE=3 SV=2
9	AFDB:F1P3H0	0.643	0.615	8.588E-63	533	0.485	0.463	F1P3H0.pdb.gz	F1P3H0_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1A PE=3 SV=1
10	AFDB:Q9W629	0.635	0.610	1.016E-62	530	0.473	0.455	Q9W629.pdb.gz	Q9W629_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=bmpr1b PE=2 SV=1
11	PDB:1k9aB	0.439	0.504	1.658E-16	441	0.157	0.181	1k9aB.pdb.gz
12	PDB:2h8hA	0.422	0.477	7.531E-16	445	0.157	0.180	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:1unlA	0.416	0.697	9.967E-16	292	0.134	0.233	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
14	PDB:8dksA	0.396	0.686	1.054E-15	283	0.128	0.230	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
15	PDB:2bujA	0.426	0.719	2.585E-15	291	0.134	0.234	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
16	PDB:4krcA	0.422	0.696	2.734E-15	297	0.155	0.266	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:4btfA	0.403	0.487	2.892E-15	413	0.126	0.155	4btfA.pdb.gz
18	PDB:4yc3A	0.399	0.659	3.827E-15	295	0.138	0.237	4yc3A.pdb.gz
19	PDB:4zhxA	0.419	0.513	4.281E-15	409	0.136	0.169	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:6lk5A	0.410	0.752	4.281E-15	265	0.138	0.264	6lk5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4FUX2	0.0	583	503	0.582	0.588	A4FUX2_BOVIN receptor protein serine/threonine kinase OS=Bos taurus OX=9913 GN=ACVRL1 PE=2 SV=1
2	O73736	0.0	681	506	0.654	0.658	O73736_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=acvr1 PE=2 SV=1
3	P37023	0.0	574	503	0.589	0.596	ACVL1_HUMAN Serine/threonine-protein kinase receptor R3 OS=Homo sapiens OX=9606 GN=ACVRL1 PE=1 SV=2
4	P37172	0.0	1050	509	0.984	0.984	ACVR1_MOUSE Activin receptor type-1 OS=Mus musculus OX=10090 GN=Acvr1 PE=1 SV=2
5	P80201	0.0	1042	509	0.972	0.972	ACVR1_RAT Activin receptor type-1 OS=Rattus norvegicus OX=10116 GN=Acvr1 PE=2 SV=1
6	P80203	0.0	568	504	0.583	0.589	ACVL1_RAT Serine/threonine-protein kinase receptor R3 OS=Rattus norvegicus OX=10116 GN=Acvrl1 PE=1 SV=2
7	Q04771	0.0	1063	509	1.000	1.000	ACVR1_HUMAN Activin receptor type-1 OS=Homo sapiens OX=9606 GN=ACVR1 PE=1 SV=1
8	Q61288	0.0	585	502	0.587	0.596	ACVL1_MOUSE Serine/threonine-protein kinase receptor R3 OS=Mus musculus OX=10090 GN=Acvrl1 PE=1 SV=2
9	Q8JFB0	0.0	575	499	0.568	0.579	Q8JFB0_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=alk1 PE=2 SV=1
10	Q90ZK6	0.0	863	504	0.823	0.831	ACVR1_CHICK Activin receptor type-1 OS=Gallus gallus OX=9031 GN=ACVR1 PE=2 SV=1
11	Q95U21	5.12e-178	513	535	0.513	0.488	Q95U21_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
12	Q7JPM7	1.49e-177	513	570	0.513	0.458	Q7JPM7_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
13	A0A0B4K7J3	1.60e-177	513	582	0.513	0.448	A0A0B4K7J3_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=3 SV=1
14	Q7JQ36	1.85e-177	513	570	0.513	0.458	Q7JQ36_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
15	Q7JQ39	3.33e-177	512	570	0.513	0.458	Q7JQ39_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
16	Q7JPN8	1.54e-176	510	570	0.487	0.435	Q7JPN8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
17	Q1RLX1	3.57e-164	477	527	0.483	0.467	Q1RLX1_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=zgc:136731 PE=2 SV=1
18	B3DJG0	3.76e-164	477	526	0.483	0.468	B3DJG0_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=bmpr1a PE=2 SV=1
19	B4DY26	1.20e-159	462	434	0.462	0.541	B4DY26_HUMAN receptor protein serine/threonine kinase OS=Homo sapiens OX=9606 GN=TGFBR1 PE=1 SV=1
20	P80204	6.48e-159	462	501	0.477	0.485	TGFR1_RAT TGF-beta receptor type-1 OS=Rattus norvegicus OX=10116 GN=Tgfbr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01064 Activin_recp	7.2e-09	47.8	Activin types I and II receptor domain
2	PF01636 APH	15	16.9	Phosphotransferase enzyme family
3	PF13095 FTA2	51	15.0	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	40	14.6	Haspin like kinase domain
5	PF00069 Pkinase	3.6e-32	123.4	Protein kinase domain
6	PF17667 Pkinase_fungal	3.3	18.0	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	1.4e-32	124.6	Protein tyrosine and serine/threonine kinase
8	PF08515 TGF_beta_GS	2.5e-13	60.6	Transforming growth factor beta type I GS-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000001001

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008592	0.995	Bone morphogenetic protein 7
2	61853.ENSNLEP00000017108	0.984	Bone morphogenetic protein 2
3	61853.ENSNLEP00000015368	0.982	Bone morphogenetic protein 4
4	61853.ENSNLEP00000003942	0.981	Bone morphogenetic protein 5
5	61853.ENSNLEP00000006702	0.981	Mothers against decapentaplegic homolog
6	61853.ENSNLEP00000008547	0.979	Bone morphogenetic protein receptor, type II (serine/threonine kinase)
7	61853.ENSNLEP00000010252	0.979	Mothers against decapentaplegic homolog
8	61853.ENSNLEP00000002004	0.976	Mothers against decapentaplegic homolog
9	61853.ENSNLEP00000006554	0.968	Serine/threonine-protein kinase receptor
10	61853.ENSNLEP00000011049	0.968	Serine/threonine-protein kinase receptor
11	61853.ENSNLEP00000011403	0.968	Peptidylprolyl isomerase
12	61853.ENSNLEP00000013966	0.967	Mothers against decapentaplegic homolog
13	61853.ENSNLEP00000021478	0.954	Anti-Muellerian hormone type-2 receptor
14	61853.ENSNLEP00000017197	0.951	Serine/threonine-protein kinase receptor
15	61853.ENSNLEP00000023757	0.951	Bone morphogenetic protein receptor, type IA
16	61853.ENSNLEP00000000962	0.950	Receptor protein serine/threonine kinase
17	61853.ENSNLEP00000015776	0.947	Mothers against decapentaplegic homolog
18	61853.ENSNLEP00000014208	0.946	Bone morphogenetic protein 6
19	61853.ENSNLEP00000007053	0.945	Hemochromatosis type 2 (juvenile)
20	61853.ENSNLEP00000001091	0.928	Inhibin, beta B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004675	0.997	transmembrane receptor protein serine/threonine kinase activity
GO:0046332	0.907	SMAD binding
GO:0048185	0.878	activin binding
GO:0019955	0.869	cytokine binding
GO:0050431	0.762	transforming growth factor beta binding
GO:0005024	0.760	transforming growth factor beta receptor activity
GO:1901363	0.572	heterocyclic compound binding
GO:0097159	0.568	organic cyclic compound binding
GO:0005102	0.394	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.978	multicellular organismal process
GO:0071363	0.978	cellular response to growth factor stimulus
GO:0007178	0.976	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048856	0.975	anatomical structure development
GO:0048518	0.970	positive regulation of biological process
GO:0048519	0.969	negative regulation of biological process
GO:0071559	0.968	response to transforming growth factor beta
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0080090	0.966	regulation of primary metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0031323	0.965	regulation of cellular metabolic process
GO:0050793	0.960	regulation of developmental process
GO:0007275	0.960	multicellular organism development
GO:0048522	0.960	positive regulation of cellular process
GO:0007179	0.960	transforming growth factor beta receptor signaling pathway
GO:0048583	0.957	regulation of response to stimulus
GO:0048513	0.951	animal organ development
GO:0009653	0.950	anatomical structure morphogenesis
GO:0071773	0.947	cellular response to BMP stimulus
GO:0060393	0.943	regulation of pathway-restricted SMAD protein phosphorylation
GO:0007507	0.938	heart development
GO:0030509	0.933	BMP signaling pathway
GO:0009893	0.899	positive regulation of metabolic process
GO:0003170	0.898	heart valve development
GO:0030154	0.893	cell differentiation
GO:0060485	0.892	mesenchyme development
GO:0003279	0.880	cardiac septum development
GO:0003179	0.873	heart valve morphogenesis
GO:0060411	0.870	cardiac septum morphogenesis
GO:0090092	0.867	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0003230	0.856	cardiac atrium development
GO:0090100	0.856	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0045595	0.847	regulation of cell differentiation
GO:0010604	0.847	positive regulation of macromolecule metabolic process
GO:0003197	0.819	endocardial cushion development
GO:0048523	0.815	negative regulation of cellular process
GO:0071704	0.813	organic substance metabolic process
GO:0010717	0.808	regulation of epithelial to mesenchymal transition
GO:0051173	0.807	positive regulation of nitrogen compound metabolic process
GO:0009889	0.806	regulation of biosynthetic process
GO:0010468	0.805	regulation of gene expression
GO:0051239	0.804	regulation of multicellular organismal process
GO:0044238	0.797	primary metabolic process
GO:0006468	0.794	protein phosphorylation
GO:0019219	0.793	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.791	regulation of macromolecule biosynthetic process
GO:0031326	0.791	regulation of cellular biosynthetic process
GO:0045597	0.784	positive regulation of cell differentiation
GO:0006355	0.778	regulation of DNA-templated transcription
GO:0031325	0.773	positive regulation of cellular metabolic process
GO:0045893	0.747	positive regulation of DNA-templated transcription
GO:0051240	0.731	positive regulation of multicellular organismal process
GO:2000026	0.722	regulation of multicellular organismal development
GO:0010718	0.705	positive regulation of epithelial to mesenchymal transition
GO:0003171	0.677	atrioventricular valve development
GO:0035239	0.656	tube morphogenesis
GO:0048598	0.652	embryonic morphogenesis
GO:0003181	0.633	atrioventricular valve morphogenesis
GO:0006950	0.590	response to stress
GO:0001944	0.584	vasculature development
GO:0072132	0.580	mesenchyme morphogenesis
GO:0003209	0.527	cardiac atrium morphogenesis
GO:0006357	0.525	regulation of transcription by RNA polymerase II
GO:0042127	0.516	regulation of cell population proliferation
GO:0045944	0.451	positive regulation of transcription by RNA polymerase II
GO:0051247	0.398	positive regulation of protein metabolic process
GO:0009892	0.377	negative regulation of metabolic process
GO:0007389	0.374	pattern specification process
GO:0042221	0.362	response to chemical
GO:0003002	0.348	regionalization
GO:0048585	0.319	negative regulation of response to stimulus
GO:0010605	0.303	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.980	protein-containing complex
GO:0043235	0.930	receptor complex
GO:0098796	0.912	membrane protein complex
GO:0098797	0.850	plasma membrane protein complex
GO:0005622	0.820	intracellular anatomical structure
GO:0098802	0.794	plasma membrane signaling receptor complex
GO:0005737	0.629	cytoplasm
GO:0043231	0.502	intracellular membrane-bounded organelle
GO:1990234	0.463	transferase complex
GO:0061695	0.402	transferase complex, transferring phosphorus-containing groups
GO:1902554	0.387	serine/threonine protein kinase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.997	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.997	receptor protein serine/threonine kinase.

[back to server]