StarFunc result for job id Q04828

User Input

>input (323 residues)
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52895	0.993	0.993	7.533E-66	323	0.978	0.978	P52895.pdb.gz	AK1C2_HUMAN Aldo-keto reductase family 1 member C2 OS=Homo sapiens OX=9606 GN=AKR1C2 PE=1 SV=3
2	PDB:4l1wA	0.997	0.990	8.161E-64	325	0.975	0.969	4l1wA.pdb.gz	Human 3-alpha hydroxysteroid dehydrogenase type 3 (3 alpha-HSD3): The V54L mutation restricting the steroid alternative binding and enhancing the 20 alpha-HSD activity
3	AFDB:P42330	0.991	0.991	5.778E-63	323	0.879	0.879	P42330.pdb.gz	AK1C3_HUMAN Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4
4	PDB:4zfcB	0.975	0.984	1.183E-59	320	0.867	0.875	4zfcB.pdb.gz	In vitro inhibition of AKR1Cs by sulphonylureas and the structural basis
5	PDB:2fvlA	0.986	0.986	4.573E-59	323	0.830	0.830	2fvlA.pdb.gz	Crystal structure of human 3-alpha hydroxysteroid/dihydrodiol dehydrogenase (AKR1C4) complexed with NADP+
6	AFDB:P17516	0.989	0.989	6.244E-59	323	0.827	0.827	P17516.pdb.gz	AK1C4_HUMAN Aldo-keto reductase family 1 member C4 OS=Homo sapiens OX=9606 GN=AKR1C4 PE=1 SV=3
7	AFDB:P70694	0.992	0.992	9.893E-58	323	0.768	0.768	P70694.pdb.gz	DHB5_MOUSE Estradiol 17 beta-dehydrogenase 5 OS=Mus musculus OX=10090 GN=Akr1c6 PE=1 SV=1
8	AFDB:Q3MHS3	0.988	0.988	4.561E-57	323	0.755	0.755	Q3MHS3.pdb.gz	Q3MHS3_RAT Aldo-keto reductase family 1, member C1 OS=Rattus norvegicus OX=10116 GN=Akr1c1 PE=1 SV=1
9	AFDB:Q91WR5	0.995	0.995	5.441E-57	323	0.734	0.734	Q91WR5.pdb.gz	AK1CL_MOUSE Aldo-keto reductase family 1 member C21 OS=Mus musculus OX=10090 GN=Akr1c21 PE=1 SV=2
10	AFDB:P51652	0.991	0.991	2.208E-55	323	0.687	0.687	P51652.pdb.gz	AKC1H_RAT Aldo-keto reductase family 1 member C18 OS=Rattus norvegicus OX=10116 GN=Akr1c18 PE=1 SV=1
11	PDB:3cv6A	0.984	0.984	4.659E-55	323	0.737	0.737	3cv6A.pdb.gz	Structure of the G225P/G226P mutant of mouse 3(17)alpha-hydroxysteroid dehydrogenase (AKR1C21) ternary complex: implications for the binding of inhibitor and substrate.
12	AFDB:Q1HE49	0.977	0.980	5.656E-55	322	0.706	0.708	Q1HE49.pdb.gz	Q1HE49_PIG Aldo-keto reductase family 1 member C4 OS=Sus scrofa OX=9823 GN=AKR1C4 PE=3 SV=1
13	AFDB:D3ZF77	0.985	0.982	9.600E-55	324	0.697	0.694	D3ZF77.pdb.gz	AK1CA_RAT Aldo-keto reductase family 1 member C15 OS=Rattus norvegicus OX=10116 GN=Akr1c15 PE=1 SV=1
14	AFDB:Q91WT7	0.988	0.988	1.018E-54	323	0.681	0.681	Q91WT7.pdb.gz	Q91WT7_MOUSE 3-alpha-hydroxysteroid dehydrogenase type 1 OS=Mus musculus OX=10090 GN=Akr1c14 PE=1 SV=1
15	PDB:3ln3A	0.970	0.982	1.181E-53	319	0.659	0.668	3ln3A.pdb.gz	Crystal structure of Putative reductase (NP_038806.2) from MUS MUSCULUS at 1.18 A resolution
16	PDB:1afsA	0.970	0.982	1.316E-52	319	0.684	0.693	1afsA.pdb.gz	Steroid recognition and regulation of hormone action: crystal structure of testosterone and NADP+ bound to 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase.
17	PDB:3burA	0.970	0.964	3.022E-47	325	0.573	0.569	3burA.pdb.gz	Crystal Structure of Human Liver {Delta}4-3-Ketosteroid 5{beta}-Reductase (AKR1D1) and Implications for Substrate Binding and Catalysis.
18	PDB:3rx2A	0.942	0.956	3.856E-42	318	0.474	0.481	3rx2A.pdb.gz	The molecular basis for inhibition of sulindac and its metabolites towards human aldose reductase
19	PDB:4gq0A	0.939	0.953	4.830E-41	318	0.471	0.478	4gq0A.pdb.gz	Crystal structure of AKR1B10 complexed with NADP+ and Caffeic acid phenethyl ester
20	PDB:3o3rA	0.943	0.967	1.089E-39	315	0.458	0.470	3o3rA.pdb.gz	Structure of rat aldose reductase-like protein AKR1B14 holoenzyme: Probing the role of His269 in coenzyme binding by site-directed mutagenesis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17516	0.0	566	323	0.827	0.827	AK1C4_HUMAN Aldo-keto reductase family 1 member C4 OS=Homo sapiens OX=9606 GN=AKR1C4 PE=1 SV=3
2	P42330	0.0	595	323	0.879	0.879	AK1C3_HUMAN Aldo-keto reductase family 1 member C3 OS=Homo sapiens OX=9606 GN=AKR1C3 PE=1 SV=4
3	P52895	0.0	655	323	0.978	0.978	AK1C2_HUMAN Aldo-keto reductase family 1 member C2 OS=Homo sapiens OX=9606 GN=AKR1C2 PE=1 SV=3
4	P70694	0.0	535	323	0.768	0.768	DHB5_MOUSE Estradiol 17 beta-dehydrogenase 5 OS=Mus musculus OX=10090 GN=Akr1c6 PE=1 SV=1
5	Q04828	0.0	670	323	1.000	1.000	AK1C1_HUMAN Aldo-keto reductase family 1 member C1 OS=Homo sapiens OX=9606 GN=AKR1C1 PE=1 SV=1
6	Q3MHS3	0.0	516	323	0.755	0.755	Q3MHS3_RAT Aldo-keto reductase family 1, member C1 OS=Rattus norvegicus OX=10116 GN=Akr1c1 PE=1 SV=1
7	Q5I0L1	0.0	513	322	0.752	0.755	Q5I0L1_RAT Akr1c1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Akr1c1 PE=2 SV=1
8	Q91WR5	8.91e-180	501	323	0.734	0.734	AK1CL_MOUSE Aldo-keto reductase family 1 member C21 OS=Mus musculus OX=10090 GN=Akr1c21 PE=1 SV=2
9	Q8K023	1.05e-178	498	323	0.718	0.718	AKC1H_MOUSE Aldo-keto reductase family 1 member C18 OS=Mus musculus OX=10090 GN=Akr1c18 PE=1 SV=2
10	Q1HE49	4.31e-175	489	322	0.706	0.708	Q1HE49_PIG Aldo-keto reductase family 1 member C4 OS=Sus scrofa OX=9823 GN=AKR1C4 PE=3 SV=1
11	Q2TJA5	4.70e-174	486	322	0.703	0.705	Q2TJA5_PIG Aldo-keto reductase OS=Sus scrofa OX=9823 GN=AKR1C8 PE=1 SV=1
12	P51652	4.92e-174	486	323	0.687	0.687	AKC1H_RAT Aldo-keto reductase family 1 member C18 OS=Rattus norvegicus OX=10116 GN=Akr1c18 PE=1 SV=1
13	D3ZF77	4.69e-171	479	324	0.697	0.694	AK1CA_RAT Aldo-keto reductase family 1 member C15 OS=Rattus norvegicus OX=10116 GN=Akr1c15 PE=1 SV=1
14	Q91WT7	7.55e-170	476	323	0.681	0.681	Q91WT7_MOUSE 3-alpha-hydroxysteroid dehydrogenase type 1 OS=Mus musculus OX=10090 GN=Akr1c14 PE=1 SV=1
15	P23457	2.48e-169	474	322	0.690	0.693	DIDH_RAT 3-alpha-hydroxysteroid dehydrogenase OS=Rattus norvegicus OX=10116 GN=Akr1c9 PE=1 SV=1
16	Q91X42	1.53e-167	470	323	0.687	0.687	Q91X42_MOUSE Aldo-keto reductase family 1, member C12 OS=Mus musculus OX=10090 GN=Akr1c12 PE=2 SV=1
17	Q9JLI0	1.60e-167	470	323	0.687	0.687	Q9JLI0_MOUSE Aldo-keto reductase a OS=Mus musculus OX=10090 GN=Akr1c12 PE=1 SV=1
18	Q9R0M7	8.62e-167	468	323	0.684	0.684	Q9R0M7_MOUSE Aldo-keto reductase AKR1C12 OS=Mus musculus OX=10090 GN=Akr1c12 PE=2 SV=1
19	Q8VC28	4.38e-164	461	323	0.669	0.669	AK1CD_MOUSE Aldo-keto reductase family 1 member C13 OS=Mus musculus OX=10090 GN=Akr1c13 PE=1 SV=2
20	H0ZPZ0	1.70e-151	430	326	0.625	0.620	H0ZPZ0_TAEGU Aldo-keto reductase family 1 member D1 OS=Taeniopygia guttata OX=59729 GN=AKR1D1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00248 Aldo_ket_red	4.2e-54	195.2	Aldo/keto reductase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370254

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370129	0.992	Aldo-keto reductase family 1 member C2
2	9606.ENSP00000369927	0.989	Aldo-keto reductase family 1 member C3
3	9606.ENSP00000242375	0.987	3-oxo-5-beta-steroid 4-dehydrogenase
4	9606.ENSP00000221403	0.977	Dihydrodiol dehydrogenase
5	9606.ENSP00000274192	0.971	3-oxo-5-alpha-steroid 4-dehydrogenase 1
6	9606.ENSP00000358421	0.953	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
7	9606.ENSP00000477587	0.951	3-oxo-5-alpha-steroid 4-dehydrogenase 2
8	9606.ENSP00000445122	0.948	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
9	9606.ENSP00000369050	0.944	Cytochrome P450 1A1
10	9606.ENSP00000480004	0.943	Epoxide hydrolase 1
11	9606.ENSP00000358903	0.938	Steroid 17-alpha-hydroxylase/17,20 lyase
12	9606.ENSP00000264228	0.934	Polyprenol reductase
13	9606.ENSP00000440689	0.933	Cytochrome P450 2E1
14	9606.ENSP00000337915	0.925	Cytochrome P450 3A4
15	9606.ENSP00000292427	0.918	Cytochrome P450 11B1, mitochondrial
16	9606.ENSP00000301141	0.917	Cytochrome P450 2A6
17	9606.ENSP00000332679	0.916	Cytochrome P450 2A13
18	9606.ENSP00000408860	0.915	Steroid 21-hydroxylase
19	9606.ENSP00000325822	0.913	Cytochrome P450 11B2, mitochondrial
20	9606.ENSP00000353820	0.908	Cytochrome P450 2D6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004033	0.999	aldo-keto reductase (NADP) activity
GO:0016229	0.998	steroid dehydrogenase activity
GO:0005488	0.991	binding
GO:0008106	0.978	alcohol dehydrogenase (NADP+) activity
GO:0004032	0.957	alditol:NADP+ 1-oxidoreductase activity
GO:0033764	0.949	steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0005515	0.865	protein binding
GO:0097159	0.458	organic cyclic compound binding
GO:1901363	0.364	heterocyclic compound binding
GO:0016651	0.318	oxidoreductase activity, acting on NAD(P)H
GO:0036094	0.316	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.997	lipid metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044281	0.933	small molecule metabolic process
GO:1901360	0.920	organic cyclic compound metabolic process
GO:0065007	0.910	biological regulation
GO:0008202	0.866	steroid metabolic process
GO:0050896	0.758	response to stimulus
GO:0042221	0.696	response to chemical
GO:0065008	0.520	regulation of biological quality
GO:0042445	0.502	hormone metabolic process
GO:0019752	0.487	carboxylic acid metabolic process
GO:0032787	0.483	monocarboxylic acid metabolic process
GO:0006066	0.457	alcohol metabolic process
GO:0009058	0.435	biosynthetic process
GO:1901576	0.433	organic substance biosynthetic process
GO:0051716	0.408	cellular response to stimulus
GO:0008610	0.388	lipid biosynthetic process
GO:0070887	0.384	cellular response to chemical stimulus
GO:0044255	0.368	cellular lipid metabolic process
GO:0050789	0.301	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0031982	0.994	vesicle
GO:0043230	0.993	extracellular organelle
GO:0070062	0.978	extracellular exosome
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0016020	0.701	membrane
GO:0005634	0.682	nucleus
GO:0012505	0.520	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	0.999	With NAD(+) or NADP(+) as acceptor.
RHEA:15937	0.978	a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH
EC:1.1.1.2	0.978	alcohol dehydrogenase (NADP(+)).
RHEA:12789	0.957	an alditol + NADP(+) = an aldose + H(+) + NADPH
EC:1.1.1.21	0.957	aldose reductase.
EC:1.6.-.-	0.318	Acting on NADH or NADPH.

[back to server]