StarFunc result for job id Q04837

User Input

>input (148 residues)
MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLA
TNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYM
DKNNVRRQATTIIADNIIFLSDQTKEKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D1U3	0.785	0.785	3.345E-25	148	1.000	1.000	A4D1U3.pdb.gz	A4D1U3_HUMAN Single-stranded DNA-binding protein OS=Homo sapiens OX=9606 GN=SSBP1 PE=2 SV=1
2	AFDB:Q9CYR0	0.805	0.784	2.244E-23	152	0.838	0.816	Q9CYR0.pdb.gz	SSBP_MOUSE Single-stranded DNA-binding protein, mitochondrial OS=Mus musculus OX=10090 GN=Ssbp1 PE=1 SV=1
3	PDB:6rupA	0.679	0.895	2.504E-18	111	0.730	0.973	6rupA.pdb.gz	Dominant mutations in mtDNA maintenance gene SSBP1 cause optic atrophy and foveopathy.
4	AFDB:P54622	0.706	0.715	2.083E-14	146	0.392	0.397	P54622.pdb.gz	SSBP_DROME Single-stranded DNA-binding protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mtSSB PE=1 SV=2
5	PDB:2dudA	0.614	0.943	5.205E-14	95	0.541	0.842	2dudA.pdb.gz
6	AFDB:Q8I415	0.716	0.389	2.164E-12	284	0.311	0.162	Q8I415.pdb.gz	Q8I415_PLAF7 Single-stranded DNA-binding protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0508800 PE=1 SV=1
7	AFDB:Q9A894	0.699	0.623	3.145E-11	167	0.257	0.228	Q9A894.pdb.gz	SSB_CAUVC Single-stranded DNA-binding protein OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=ssb PE=3 SV=1
8	AFDB:Q3IJB1	0.690	0.429	4.133E-11	244	0.250	0.152	Q3IJB1.pdb.gz	Q3IJB1_PSET1 Single-stranded DNA-binding protein OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=ssb PE=3 SV=1
9	AFDB:P0AGE0	0.697	0.586	6.757E-11	178	0.250	0.208	P0AGE0.pdb.gz	SSB_ECOLI Single-stranded DNA-binding protein OS=Escherichia coli (strain K12) OX=83333 GN=ssb PE=1 SV=2
10	AFDB:P34496	0.656	0.575	1.105E-10	170	0.284	0.247	P34496.pdb.gz	MTSS1_CAEEL Single-stranded DNA-binding protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mtss-1 PE=1 SV=2
11	AFDB:Q84J78	0.679	0.509	1.232E-10	201	0.243	0.179	Q84J78.pdb.gz	SSBP_ARATH Single-stranded DNA-binding protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g11060 PE=2 SV=1
12	PDB:1eqqB	0.658	0.798	1.989E-10	120	0.250	0.308	1eqqB.pdb.gz	Roles of functional loops and the C-terminal segment of a single-stranded DNA binding protein elucidated by X-Ray structure analysis
13	AFDB:Q9LII1	0.637	0.447	1.696E-9	217	0.230	0.157	Q9LII1.pdb.gz	Q9LII1_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=SSB2 PE=1 SV=1
14	PDB:7f5yB	0.658	0.796	1.853E-8	120	0.128	0.158	7f5yB.pdb.gz
15	PDB:2cczA	0.564	0.676	1.313E-6	121	0.149	0.182	2cczA.pdb.gz	Complexed Crystal Structure of Replication Restart Primsome Protein Prib Reveals a Novel Single-Stranded DNA-Binding Mode.
16	PDB:1ue6A	0.547	0.714	1.464E-6	110	0.122	0.164	1ue6A.pdb.gz
17	PDB:1z9fA	0.500	0.814	2.394E-6	89	0.189	0.315	1z9fA.pdb.gz
18	PDB:3k81D	0.605	0.827	2.821E-6	106	0.176	0.245	3k81D.pdb.gz
19	PDB:1ue7B	0.488	0.720	1.534E-5	98	0.122	0.184	1ue7B.pdb.gz
20	PDB:3k8aB	0.463	0.632	1.440E-4	103	0.101	0.146	3k8aB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D1U3	5.30e-108	305	148	1.000	1.000	A4D1U3_HUMAN Single-stranded DNA-binding protein OS=Homo sapiens OX=9606 GN=SSBP1 PE=2 SV=1
2	Q04837	5.30e-108	305	148	1.000	1.000	SSBP_HUMAN Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1
3	E7EUY5	7.25e-98	279	135	0.912	1.000	E7EUY5_HUMAN Single-stranded DNA-binding protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1
4	Q9CYR0	1.52e-91	264	152	0.831	0.809	SSBP_MOUSE Single-stranded DNA-binding protein, mitochondrial OS=Mus musculus OX=10090 GN=Ssbp1 PE=1 SV=1
5	C9K0U8	5.18e-87	251	121	0.818	1.000	C9K0U8_HUMAN Single-stranded DNA-binding protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1
6	P54622	1.15e-29	107	146	0.345	0.349	SSBP_DROME Single-stranded DNA-binding protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mtSSB PE=1 SV=2
7	Q8I415	2.97e-19	83.6	284	0.311	0.162	Q8I415_PLAF7 Single-stranded DNA-binding protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0508800 PE=1 SV=1
8	Q9A894	7.62e-16	72.0	167	0.250	0.222	SSB_CAUVC Single-stranded DNA-binding protein OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=ssb PE=3 SV=1
9	P0AGE0	2.15e-15	71.2	178	0.243	0.202	SSB_ECOLI Single-stranded DNA-binding protein OS=Escherichia coli (strain K12) OX=83333 GN=ssb PE=1 SV=2
10	Q3IJB1	4.46e-14	68.9	244	0.250	0.152	Q3IJB1_PSET1 Single-stranded DNA-binding protein OS=Pseudoalteromonas translucida (strain TAC 125) OX=326442 GN=ssb PE=3 SV=1
11	P34496	2.05e-08	52.4	170	0.236	0.206	MTSS1_CAEEL Single-stranded DNA-binding protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mtss-1 PE=1 SV=2
12	Q84J78	5.35e-08	52.0	201	0.203	0.149	SSBP_ARATH Single-stranded DNA-binding protein, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g11060 PE=2 SV=1
13	Q9LII1	5.10e-06	46.6	217	0.203	0.138	Q9LII1_ARATH Nucleic acid-binding, OB-fold-like protein OS=Arabidopsis thaliana OX=3702 GN=SSB2 PE=1 SV=1
14	Q9WZ73	5.25e-06	45.4	141	0.189	0.199	SSB_THEMA Single-stranded DNA-binding protein OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=ssb PE=1 SV=1
15	O25841	2.13e-05	44.3	179	0.182	0.151	SSB_HELPY Single-stranded DNA-binding protein OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=ssb PE=1 SV=1
16	P66854	0.001	39.7	156	0.203	0.192	SSB_STRPN Single-stranded DNA-binding protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ssb PE=1 SV=1
17	Q7X7H9	0.28	33.1	287	0.176	0.091	SK3_ORYSJ Shikimate kinase 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SK3 PE=1 SV=2
18	P32445	0.43	32.0	135	0.169	0.185	RIM1_YEAST Single-stranded DNA-binding protein RIM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIM1 PE=1 SV=1
19	Q21436	4.9	29.6	1696	0.149	0.013	Q21436_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-3 PE=1 SV=1
20	Q3HKQ3	4.9	29.3	356	0.209	0.087	Q3HKQ3_DROME Male accessory gland protein OS=Drosophila melanogaster OX=7227 GN=Spn75F PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00436 SSB	5.1e-28	108.5	Single-strand binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419665

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309595	0.991	Twinkle protein, mitochondrial
2	9606.ENSP00000420588	0.945	Transcription factor A, mitochondrial
3	9606.ENSP00000268124	0.932	DNA polymerase subunit gamma-1
4	9606.ENSP00000220429	0.931	GA-binding protein subunit beta-1
5	9606.ENSP00000346886	0.914	GA-binding protein alpha chain
6	9606.ENSP00000363360	0.907	SOSS complex subunit C
7	9606.ENSP00000269305	0.903	Cellular tumor antigen p53
8	9606.ENSP00000483921	0.901	Single stranded DNA binding protein 2
9	9606.ENSP00000318641	0.900	Integrator complex subunit 3
10	9606.ENSP00000465759	0.892	DNA-directed RNA polymerase, mitochondrial
11	9606.ENSP00000313816	0.888	DNA-directed primase/polymerase protein
12	9606.ENSP00000383949	0.847	NHP2-like protein 1
13	9606.ENSP00000376732	0.841	Mitochondrial ribosomal protein S33
14	9606.ENSP00000254940	0.834	60S ribosome subunit biogenesis protein NIP7 homolog
15	9606.ENSP00000291458	0.829	Coiled-coil domain containing 58
16	9606.ENSP00000274606	0.828	H/ACA ribonucleoprotein complex subunit 2
17	9606.ENSP00000266735	0.823	Small nuclear ribonucleoprotein F
18	9606.ENSP00000254719	0.821	Replication protein A 70 kDa DNA-binding subunit
19	9606.ENSP00000382250	0.820	Mitochondrial ribosomal protein S6
20	9606.ENSP00000442563	0.810	DNA polymerase subunit gamma-2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003697	1.000	single-stranded DNA binding
GO:0003723	0.998	RNA binding
GO:0003682	0.997	chromatin binding
GO:0046983	0.997	protein dimerization activity
GO:0042803	0.992	protein homodimerization activity
GO:0003824	0.306	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0006996	0.987	organelle organization
GO:0044238	0.986	primary metabolic process
GO:0006807	0.962	nitrogen compound metabolic process
GO:0050794	0.955	regulation of cellular process
GO:0043170	0.938	macromolecule metabolic process
GO:0031323	0.937	regulation of cellular metabolic process
GO:0019219	0.932	regulation of nucleobase-containing compound metabolic process
GO:0006139	0.927	nucleobase-containing compound metabolic process
GO:0060255	0.923	regulation of macromolecule metabolic process
GO:0009893	0.916	positive regulation of metabolic process
GO:0044260	0.915	cellular macromolecule metabolic process
GO:0090304	0.910	nucleic acid metabolic process
GO:0048522	0.897	positive regulation of cellular process
GO:0065003	0.892	protein-containing complex assembly
GO:0090329	0.888	regulation of DNA-templated DNA replication
GO:0006260	0.866	DNA replication
GO:0045740	0.838	positive regulation of DNA replication
GO:0051259	0.806	protein complex oligomerization
GO:0006261	0.792	DNA-templated DNA replication
GO:0071103	0.789	DNA conformation change
GO:0032392	0.758	DNA geometric change
GO:0032508	0.752	DNA duplex unwinding
GO:0006268	0.710	DNA unwinding involved in DNA replication
GO:0033044	0.676	regulation of chromosome organization
GO:0043085	0.670	positive regulation of catalytic activity
GO:0010821	0.632	regulation of mitochondrion organization
GO:0010822	0.617	positive regulation of mitochondrion organization
GO:0043462	0.598	regulation of ATP-dependent activity
GO:0051262	0.589	protein tetramerization
GO:2000105	0.575	positive regulation of DNA-templated DNA replication
GO:0032781	0.516	positive regulation of ATP-dependent activity
GO:0051260	0.468	protein homooligomerization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.940	intracellular organelle lumen
GO:0043232	0.843	intracellular non-membrane-bounded organelle
GO:0005634	0.832	nucleus
GO:0031981	0.536	nuclear lumen
GO:0005759	0.407	mitochondrial matrix
GO:0032991	0.354	protein-containing complex
GO:0005654	0.311	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]