StarFunc result for job id Q04864

User Input

>input (619 residues)
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYF
KKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP
RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSA
DLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMS
SSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGI
GSMQNEQLSDSFPYEFFQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q04864	0.999	0.999	1.191E-97	619	1.000	1.000	Q04864.pdb.gz	REL_HUMAN Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1
2	AFDB:P15307	0.497	0.524	6.084E-75	587	0.709	0.748	P15307.pdb.gz	REL_MOUSE Proto-oncogene c-Rel OS=Mus musculus OX=10090 GN=Rel PE=1 SV=2
3	AFDB:P16236	0.494	0.511	3.749E-61	598	0.507	0.525	P16236.pdb.gz	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
4	AFDB:Q6DGE6	0.490	0.509	5.197E-55	596	0.441	0.458	Q6DGE6.pdb.gz	Q6DGE6_DANRE Proto-oncogene c-Rel OS=Danio rerio OX=7955 GN=c-rel PE=1 SV=1
5	AFDB:Q04206	0.470	0.527	1.456E-50	551	0.365	0.410	Q04206.pdb.gz	TF65_HUMAN Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=2
6	AFDB:B3DHW2	0.453	0.613	3.659E-50	455	0.354	0.481	B3DHW2.pdb.gz	B3DHW2_DANRE Transcription factor p65 OS=Danio rerio OX=7955 GN=nfkb3 PE=1 SV=1
7	AFDB:D4A8H1	0.460	0.509	1.207E-41	558	0.297	0.330	D4A8H1.pdb.gz	D4A8H1_RAT RELB proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Relb PE=4 SV=4
8	AFDB:Q01201	0.461	0.492	3.569E-41	579	0.286	0.306	Q01201.pdb.gz	RELB_HUMAN Transcription factor RelB OS=Homo sapiens OX=9606 GN=RELB PE=1 SV=2
9	AFDB:A0A0G2JTY4	0.242	0.152	3.401E-17	1076	0.155	0.089	A0A0G2JTY4.pdb.gz	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
10	AFDB:B5B2S1	0.235	0.149	4.707E-17	1075	0.187	0.108	B5B2S1.pdb.gz	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
11	PDB:2q3zA	0.177	0.170	6.415E-5	655	0.042	0.040	2q3zA.pdb.gz	Transglutaminase 2 undergoes a large conformational change upon activation
12	PDB:3s3sA	0.183	0.182	1.103E-4	620	0.042	0.042	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease
13	PDB:4pygA	0.186	0.172	3.260E-4	685	0.039	0.035	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
14	PDB:6kzbC	0.196	0.189	3.633E-4	649	0.039	0.037	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
15	PDB:7tvzE	0.164	0.156	4.049E-4	665	0.032	0.030	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
16	PDB:7nxdA	0.182	0.138	6.245E-4	905	0.050	0.034	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
17	PDB:1l9mB	0.186	0.173	6.593E-4	681	0.044	0.040	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
18	PDB:7cztH	0.125	0.232	7.348E-4	221	0.039	0.109	7cztH.pdb.gz
19	PDB:7uslA	0.147	0.116	1.074E-3	856	0.052	0.037	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
20	PDB:1c12A	0.136	0.269	1.486E-3	214	0.040	0.117	1c12A.pdb.gz	Insight into odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5XW27	0.0	864	585	0.717	0.759	A0A8I5XW27_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=1
2	A0A8I6ABJ7	0.0	872	595	0.724	0.753	A0A8I6ABJ7_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=1
3	F1M5R1	0.0	832	566	0.698	0.763	F1M5R1_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=3
4	P15307	0.0	838	587	0.708	0.746	REL_MOUSE Proto-oncogene c-Rel OS=Mus musculus OX=10090 GN=Rel PE=1 SV=2
5	P16236	0.0	566	598	0.522	0.540	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
6	Q04864	0.0	1288	619	1.000	1.000	REL_HUMAN Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1
7	Q6DGE6	1.62e-164	484	596	0.360	0.374	Q6DGE6_DANRE Proto-oncogene c-Rel OS=Danio rerio OX=7955 GN=c-rel PE=1 SV=1
8	B3DHW2	1.41e-135	405	455	0.318	0.433	B3DHW2_DANRE Transcription factor p65 OS=Danio rerio OX=7955 GN=nfkb3 PE=1 SV=1
9	A0A087X0W8	1.40e-128	387	448	0.309	0.426	A0A087X0W8_HUMAN RELA proto-oncogene, NF-kB subunit OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
10	Q2TAM5	4.18e-128	384	377	0.307	0.504	Q2TAM5_HUMAN RELA protein OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
11	Q04206	8.31e-128	389	551	0.307	0.345	TF65_HUMAN Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=2
12	Q04207	1.01e-127	389	549	0.305	0.344	TF65_MOUSE Transcription factor p65 OS=Mus musculus OX=10090 GN=Rela PE=1 SV=1
13	F7F7J5	2.62e-127	387	541	0.305	0.349	F7F7J5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
14	A0A8I6A5H5	3.34e-127	387	550	0.305	0.344	A0A8I6A5H5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
15	Q7TQN4	4.51e-127	387	550	0.305	0.344	Q7TQN4_RAT Nuclear factor kappaB subunit p65 OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
16	A0A8I5ZMV7	5.71e-127	387	557	0.305	0.339	A0A8I5ZMV7_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
17	E9PKH5	1.50e-125	378	418	0.309	0.457	E9PKH5_HUMAN RELA proto-oncogene, NF-kB subunit (Fragment) OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
18	A0A8I6ATQ5	1.57e-100	318	544	0.267	0.303	A0A8I6ATQ5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
19	Q96CP1	5.90e-93	288	246	0.231	0.581	Q96CP1_HUMAN RELA protein OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
20	Q8K220	5.92e-92	296	555	0.239	0.267	Q8K220_MOUSE Avian reticuloendotheliosis viral (v-rel) oncogene related B OS=Mus musculus OX=10090 GN=Relb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16179 RHD_dimer	1.3e-33	126.5	Rel homology dimerisation domain
2	PF00554 RHD_DNA_bind	8.6e-72	252.1	Rel homology DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295025

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216797	0.999	NF-kappa-B inhibitor alpha
2	9606.ENSP00000312988	0.999	NF-kappa-B inhibitor beta
3	9606.ENSP00000275015	0.997	NF-kappa-B inhibitor epsilon
4	9606.ENSP00000226574	0.993	Nuclear factor NF-kappa-B p105 subunit
5	9606.ENSP00000361359	0.989	Tumor necrosis factor receptor superfamily member 5
6	9606.ENSP00000359424	0.983	Inhibitor of nuclear factor kappa-B kinase subunit alpha
7	9606.ENSP00000430684	0.982	Inhibitor of nuclear factor kappa-B kinase subunit beta
8	9606.ENSP00000483825	0.974	NF-kappa-B essential modulator
9	9606.ENSP00000358983	0.970	Nuclear factor NF-kappa-B p100 subunit
10	9606.ENSP00000384273	0.960	Transcription factor p65
11	9606.ENSP00000221452	0.952	Transcription factor RelB
12	9606.ENSP00000263253	0.949	Histone acetyltransferase p300
13	9606.ENSP00000300589	0.948	Nucleotide-binding oligomerization domain-containing protein 2
14	9606.ENSP00000387699	0.936	Cyclic AMP-responsive element-binding protein 1
15	9606.ENSP00000380109	0.928	NF-kappa-B inhibitor delta
16	9606.ENSP00000329967	0.915	Serine/threonine-protein kinase TBK1
17	9606.ENSP00000272317	0.909	Ubiquitin-40S ribosomal protein S27a
18	9606.ENSP00000441543	0.908	Polyubiquitin-C
19	9606.ENSP00000304697	0.903	Polyubiquitin-B
20	9606.ENSP00000388107	0.903	Ubiquitin-60S ribosomal protein L40

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	1.000	sequence-specific DNA binding
GO:0003690	0.980	double-stranded DNA binding
GO:0000977	0.968	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.949	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.922	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.876	DNA-binding transcription activator activity
GO:0001228	0.863	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048519	0.988	negative regulation of biological process
GO:0009987	0.982	cellular process
GO:0050896	0.980	response to stimulus
GO:0048518	0.979	positive regulation of biological process
GO:0048523	0.971	negative regulation of cellular process
GO:0048522	0.961	positive regulation of cellular process
GO:0048583	0.943	regulation of response to stimulus
GO:0019222	0.942	regulation of metabolic process
GO:0001817	0.918	regulation of cytokine production
GO:0051716	0.888	cellular response to stimulus
GO:0023051	0.872	regulation of signaling
GO:0010646	0.871	regulation of cell communication
GO:0010604	0.871	positive regulation of macromolecule metabolic process
GO:0080090	0.854	regulation of primary metabolic process
GO:0051173	0.851	positive regulation of nitrogen compound metabolic process
GO:0031323	0.847	regulation of cellular metabolic process
GO:0007154	0.837	cell communication
GO:0023052	0.836	signaling
GO:0007165	0.829	signal transduction
GO:0060548	0.828	negative regulation of cell death
GO:0006355	0.823	regulation of DNA-templated transcription
GO:0031325	0.813	positive regulation of cellular metabolic process
GO:0007249	0.759	I-kappaB kinase/NF-kappaB signaling
GO:0009966	0.682	regulation of signal transduction
GO:1901214	0.670	regulation of neuron death
GO:0045935	0.666	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.664	positive regulation of cellular biosynthetic process
GO:0010557	0.657	positive regulation of macromolecule biosynthetic process
GO:0045893	0.654	positive regulation of DNA-templated transcription
GO:1902531	0.648	regulation of intracellular signal transduction
GO:0009967	0.645	positive regulation of signal transduction
GO:1902533	0.634	positive regulation of intracellular signal transduction
GO:1901215	0.626	negative regulation of neuron death
GO:0010605	0.620	negative regulation of macromolecule metabolic process
GO:0043122	0.479	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006357	0.462	regulation of transcription by RNA polymerase II
GO:0051240	0.412	positive regulation of multicellular organismal process
GO:0008152	0.398	metabolic process
GO:0045944	0.397	positive regulation of transcription by RNA polymerase II
GO:0006950	0.369	response to stress
GO:0071704	0.362	organic substance metabolic process
GO:0010628	0.324	positive regulation of gene expression
GO:0042221	0.314	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0032991	0.981	protein-containing complex
GO:0005829	0.973	cytosol
GO:0005667	0.329	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]