StarFunc result for job id Q04912

User Input

>input (1400 residues)
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLG
ILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG
LALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHERV
VTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNH
PNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYLA
EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVM
QQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQF
SPMPGNVRRPRPLSEPPRPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QLR7	0.471	0.477	0.000	1382	0.341	0.345	F1QLR7.pdb.gz	F1QLR7_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=c-met PE=4 SV=1
2	AFDB:F8W2F8	0.536	0.544	0.000	1376	0.404	0.411	F8W2F8.pdb.gz
3	AFDB:P08581	0.392	0.395	0.000	1390	0.343	0.345	P08581.pdb.gz	MET_HUMAN Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4
4	AFDB:P97523	0.421	0.426	0.000	1382	0.341	0.345	P97523.pdb.gz	MET_RAT Hepatocyte growth factor receptor OS=Rattus norvegicus OX=10116 GN=Met PE=1 SV=1
5	AFDB:Q04912	1.000	1.000	0.000	1400	1.000	1.000	Q04912.pdb.gz	RON_HUMAN Macrophage-stimulating protein receptor OS=Homo sapiens OX=9606 GN=MST1R PE=1 SV=3
6	AFDB:Q62190	0.747	0.758	0.000	1378	0.732	0.744	Q62190.pdb.gz	RON_MOUSE Macrophage-stimulating protein receptor OS=Mus musculus OX=10090 GN=Mst1r PE=1 SV=3
7	AFDB:O75051	0.299	0.225	1.987E-54	1894	0.166	0.122	O75051.pdb.gz	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
8	AFDB:Q9UIW2	0.304	0.229	6.059E-54	1896	0.175	0.129	Q9UIW2.pdb.gz	PLXA1_HUMAN Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 SV=3
9	AFDB:A0A2R8QPJ6	0.292	0.219	2.150E-53	1902	0.159	0.117	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
10	AFDB:Q9V491	0.276	0.202	4.836E-53	1945	0.145	0.104	Q9V491.pdb.gz	Q9V491_DROME Plexin A, isoform A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
11	PDB:6vxkB	0.244	0.428	1.441E-27	747	0.092	0.173	6vxkB.pdb.gz
12	PDB:2h8hA	0.174	0.519	1.941E-20	445	0.074	0.234	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:1k9aB	0.171	0.528	2.148E-20	441	0.072	0.229	1k9aB.pdb.gz
14	PDB:4fl2A	0.177	0.433	4.489E-19	555	0.065	0.164	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:4k2rA	0.174	0.429	8.245E-19	551	0.062	0.158	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:6qp7A	0.263	0.534	9.124E-19	620	0.079	0.177	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
17	PDB:3nvqA	0.250	0.533	2.006E-17	588	0.072	0.172	3nvqA.pdb.gz
18	PDB:4btfA	0.161	0.509	1.531E-14	413	0.046	0.155	4btfA.pdb.gz
19	PDB:8dksA	0.154	0.675	2.541E-14	283	0.054	0.269	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
20	PDB:6lk5A	0.165	0.790	4.666E-14	265	0.039	0.208	6lk5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QLR7	0.0	738	1382	0.352	0.357	F1QLR7_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=c-met PE=4 SV=1
2	P08581	0.0	743	1390	0.345	0.347	MET_HUMAN Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4
3	P16056	0.0	761	1379	0.352	0.358	MET_MOUSE Hepatocyte growth factor receptor OS=Mus musculus OX=10090 GN=Met PE=1 SV=1
4	P97523	0.0	745	1382	0.346	0.350	MET_RAT Hepatocyte growth factor receptor OS=Rattus norvegicus OX=10116 GN=Met PE=1 SV=1
5	Q04912	0.0	2842	1400	1.000	1.000	RON_HUMAN Macrophage-stimulating protein receptor OS=Homo sapiens OX=9606 GN=MST1R PE=1 SV=3
6	Q62190	0.0	2038	1378	0.735	0.747	RON_MOUSE Macrophage-stimulating protein receptor OS=Mus musculus OX=10090 GN=Mst1r PE=1 SV=3
7	Q64GK4	0.0	728	1382	0.346	0.351	Q64GK4_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=cmet PE=2 SV=1
8	Q60805	2.94e-64	240	994	0.103	0.145	MERTK_MOUSE Tyrosine-protein kinase Mer OS=Mus musculus OX=10090 GN=Mertk PE=1 SV=1
9	P57097	7.63e-64	239	994	0.091	0.129	MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus OX=10116 GN=Mertk PE=2 SV=1
10	P55146	8.31e-64	237	880	0.094	0.150	TYRO3_RAT Tyrosine-protein kinase receptor TYRO3 OS=Rattus norvegicus OX=10116 GN=Tyro3 PE=1 SV=1
11	Q06418	2.13e-63	236	890	0.089	0.140	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
12	Q9YI66	5.19e-63	234	874	0.096	0.153	TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio OX=7955 GN=tyro3 PE=2 SV=1
13	P55144	7.01e-63	234	880	0.096	0.152	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
14	Q12866	1.97e-62	234	999	0.092	0.129	MERTK_HUMAN Tyrosine-protein kinase Mer OS=Homo sapiens OX=9606 GN=MERTK PE=1 SV=2
15	A0A0G2K2H0	7.52e-62	231	879	0.088	0.140	A0A0G2K2H0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
16	E9PSX9	7.75e-62	231	858	0.088	0.143	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
17	Q8VI99	1.01e-61	231	879	0.088	0.140	Q8VI99_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=3 SV=1
18	Q8VIA0	1.15e-61	231	888	0.088	0.139	Q8VIA0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=3 SV=1
19	Q00993	1.33e-61	230	888	0.088	0.139	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
20	E9PSY0	1.93e-61	230	921	0.088	0.134	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14531 Kinase-like	23	15.8	Kinase-like
2	PF00069 Pkinase	1.6e-34	131.1	Protein kinase domain
3	PF17667 Pkinase_fungal	1.7e+02	12.4	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	1.6e-85	298.1	Protein tyrosine and serine/threonine kinase
5	PF01437 PSI	2	20.4	Plexin repeat
6	PF01403 Sema	1e-15	69.6	Sema domain
7	PF01833 TIG	4.6e-20	82.8	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296474

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414287	0.999	Hepatocyte growth factor-like protein
2	9606.ENSP00000340989	0.966	14-3-3 protein sigma
3	9606.ENSP00000371267	0.958	14-3-3 protein theta
4	9606.ENSP00000248975	0.957	14-3-3 protein eta
5	9606.ENSP00000451828	0.957	RAC-alpha serine/threonine-protein kinase
6	9606.ENSP00000264335	0.955	14-3-3 protein epsilon
7	9606.ENSP00000361930	0.955	14-3-3 protein beta/alpha
8	9606.ENSP00000379287	0.955	14-3-3 protein zeta/delta
9	9606.ENSP00000306330	0.939	14-3-3 protein gamma
10	9606.ENSP00000264033	0.938	E3 ubiquitin-protein ligase CBL
11	9606.ENSP00000376345	0.931	Growth factor receptor-bound protein 2
12	9606.ENSP00000380948	0.917	Integrin beta-2
13	9606.ENSP00000441691	0.913	Integrin alpha-M
14	9606.ENSP00000264832	0.905	Intercellular adhesion molecule 1
15	9606.ENSP00000401853	0.862	Hyaluronidase-2
16	9606.ENSP00000222139	0.776	Erythropoietin receptor
17	9606.ENSP00000418754	0.744	Inactive tyrosine-protein kinase 7
18	9606.ENSP00000345849	0.733	Hyaluronidase PH-20
19	9606.ENSP00000323856	0.718	Plectin
20	9606.ENSP00000222390	0.690	Hepatocyte growth factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	0.999	transmembrane receptor protein tyrosine kinase activity
GO:0019899	0.977	enzyme binding
GO:0005102	0.735	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0009987	0.981	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0048518	0.930	positive regulation of biological process
GO:0051716	0.899	cellular response to stimulus
GO:0023052	0.839	signaling
GO:0007154	0.831	cell communication
GO:0048522	0.812	positive regulation of cellular process
GO:0019222	0.775	regulation of metabolic process
GO:0009605	0.726	response to external stimulus
GO:0060255	0.714	regulation of macromolecule metabolic process
GO:0080090	0.691	regulation of primary metabolic process
GO:0051171	0.691	regulation of nitrogen compound metabolic process
GO:0007165	0.689	signal transduction
GO:0031323	0.687	regulation of cellular metabolic process
GO:0009615	0.671	response to virus
GO:0032502	0.620	developmental process
GO:0065009	0.607	regulation of molecular function
GO:0051246	0.594	regulation of protein metabolic process
GO:0048856	0.571	anatomical structure development
GO:0008152	0.553	metabolic process
GO:0048583	0.546	regulation of response to stimulus
GO:0032501	0.538	multicellular organismal process
GO:0044237	0.519	cellular metabolic process
GO:0031399	0.479	regulation of protein modification process
GO:0009966	0.459	regulation of signal transduction
GO:0048519	0.452	negative regulation of biological process
GO:0009893	0.452	positive regulation of metabolic process
GO:0043408	0.446	regulation of MAPK cascade
GO:0048584	0.437	positive regulation of response to stimulus
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:0010604	0.423	positive regulation of macromolecule metabolic process
GO:0019220	0.409	regulation of phosphate metabolic process
GO:0048523	0.403	negative regulation of cellular process
GO:0001932	0.401	regulation of protein phosphorylation
GO:1902533	0.385	positive regulation of intracellular signal transduction
GO:0044093	0.374	positive regulation of molecular function
GO:0050790	0.373	regulation of catalytic activity
GO:0071704	0.372	organic substance metabolic process
GO:0051247	0.369	positive regulation of protein metabolic process
GO:0044238	0.366	primary metabolic process
GO:0006807	0.360	nitrogen compound metabolic process
GO:0007166	0.352	cell surface receptor signaling pathway
GO:0043170	0.347	macromolecule metabolic process
GO:1901564	0.318	organonitrogen compound metabolic process
GO:0042327	0.305	positive regulation of phosphorylation
GO:0043549	0.304	regulation of kinase activity
GO:0042127	0.302	regulation of cell population proliferation
GO:0001934	0.301	positive regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.857	membrane-bounded organelle
GO:0005622	0.837	intracellular anatomical structure
GO:0043229	0.817	intracellular organelle
GO:0009986	0.634	cell surface
GO:0043231	0.629	intracellular membrane-bounded organelle
GO:0005737	0.623	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.999	receptor protein-tyrosine kinase.

[back to server]