StarFunc result for job id Q05066

User Input

>input (204 residues)
MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV
KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH
REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL
GHLPPINAASSPQQRDRYSHWTKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05066	1.000	1.000	2.419E-31	204	1.000	1.000	Q05066.pdb.gz	SRY_HUMAN Sex-determining region Y protein OS=Homo sapiens OX=9606 GN=SRY PE=1 SV=1
2	AFDB:Q9PSV6	0.436	0.286	7.600E-12	316	0.397	0.256	Q9PSV6.pdb.gz	Q9PSV6_CHICK SOX3 OS=Gallus gallus OX=9031 GN=Sox3 PE=2 SV=1
3	AFDB:D4A543	0.426	0.278	5.001E-11	319	0.397	0.254	D4A543.pdb.gz	D4A543_RAT SRY-box transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Sox2 PE=4 SV=1
4	AFDB:P55863	0.433	0.293	5.001E-11	309	0.402	0.265	P55863.pdb.gz	SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis OX=8355 GN=sox3-a PE=1 SV=1
5	AFDB:O42569	0.419	0.279	1.091E-10	311	0.407	0.267	O42569.pdb.gz	SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis OX=8355 GN=sox2 PE=1 SV=1
6	AFDB:Q2PG84	0.423	0.227	2.378E-10	393	0.324	0.168	Q2PG84.pdb.gz	SOX1_XENLA Transcription factor Sox-1 OS=Xenopus laevis OX=8355 GN=sox1 PE=2 SV=1
7	AFDB:Q6EJB7	0.423	0.294	3.291E-10	300	0.407	0.277	Q6EJB7.pdb.gz	SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio OX=7955 GN=sox3 PE=1 SV=1
8	AFDB:Q6DGL6	0.411	0.255	4.860E-10	336	0.358	0.217	Q6DGL6.pdb.gz	SOX1A_DANRE Transcription factor Sox-1a OS=Danio rerio OX=7955 GN=sox1a PE=2 SV=2
9	AFDB:Q6P0E1	0.418	0.274	4.860E-10	315	0.373	0.241	Q6P0E1.pdb.gz	SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio OX=7955 GN=sox2 PE=2 SV=1
10	AFDB:B0ZTE2	0.408	0.349	5.186E-10	239	0.324	0.276	B0ZTE2.pdb.gz	SOX14_XENLA Transcription factor Sox-14 OS=Xenopus laevis OX=8355 GN=sox14 PE=2 SV=1
11	PDB:1j5nA	0.296	0.611	5.115E-3	93	0.103	0.226	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.217	0.102	1.280	451	0.044	0.020	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:7fbyA	0.109	0.136	3.178	153	0.054	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:7n9sA	0.135	0.018	5.008	2365	0.049	0.004	7n9sA.pdb.gz
15	PDB:2cyyA	0.109	0.138	6.086	151	0.064	0.086	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
16	PDB:6zm7CE	0.172	0.281	8.422	124	0.054	0.089	6zm7CE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
17	PDB:4bwrA	0.095	0.055	8.987	467	0.044	0.019	4bwrA.pdb.gz	Crystal Structure of C5321: A Protective Antigen Present in Uropathogenic Escherichia Coli Strains Displaying an Slr Fold.
18	PDB:5u6yA	0.092	0.052	9.591	459	0.044	0.020	5u6yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05066	6.28e-155	428	204	1.000	1.000	SRY_HUMAN Sex-determining region Y protein OS=Homo sapiens OX=9606 GN=SRY PE=1 SV=1
2	P36394	8.36e-41	138	169	0.348	0.420	SRY_RAT Sex-determining region Y protein OS=Rattus norvegicus OX=10116 GN=Sry PE=1 SV=3
3	O42569	5.89e-39	137	311	0.363	0.238	SOX2_XENLA Transcription factor Sox-2 OS=Xenopus laevis OX=8355 GN=sox2 PE=1 SV=1
4	P48430	4.58e-38	135	315	0.363	0.235	SOX2_CHICK Transcription factor SOX-2 OS=Gallus gallus OX=9031 GN=SOX2 PE=1 SV=1
5	Q6EJB7	1.03e-37	134	300	0.392	0.267	SOX3_DANRE Transcription factor Sox-3 OS=Danio rerio OX=7955 GN=sox3 PE=1 SV=1
6	P55863	1.50e-37	134	309	0.412	0.272	SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis OX=8355 GN=sox3-a PE=1 SV=1
7	Q9PSV6	3.25e-37	133	316	0.348	0.225	Q9PSV6_CHICK SOX3 OS=Gallus gallus OX=9031 GN=Sox3 PE=2 SV=1
8	Q21305	4.29e-37	132	283	0.309	0.223	SOX2_CAEEL Transcription factor sox-2 OS=Caenorhabditis elegans OX=6239 GN=sox-2 PE=1 SV=2
9	Q05738	8.03e-37	134	392	0.328	0.171	SRY_MOUSE Sex-determining region Y protein OS=Mus musculus OX=10090 GN=Sry PE=1 SV=3
10	P48433	1.06e-36	132	312	0.348	0.228	SOX3_CHICK Transcription factor SOX-3 OS=Gallus gallus OX=9031 GN=SOX3 PE=2 SV=1
11	Q20201	1.16e-36	129	212	0.309	0.297	SOX3_CAEEL Transcription factor sox-3 OS=Caenorhabditis elegans OX=6239 GN=sox-3 PE=2 SV=1
12	Q9DDD7	3.93e-36	130	292	0.328	0.229	SX19B_DANRE Transcription factor Sox-19b OS=Danio rerio OX=7955 GN=sox19b PE=1 SV=1
13	Q2Z1R2	3.94e-36	131	340	0.294	0.176	SOX1B_DANRE Transcription factor Sox-1b OS=Danio rerio OX=7955 GN=sox1b PE=2 SV=1
14	Q6P0E1	6.65e-36	129	315	0.353	0.229	SOX2_DANRE Transcription factor Sox-2 OS=Danio rerio OX=7955 GN=sox2 PE=2 SV=1
15	D4A543	1.82e-35	129	319	0.353	0.226	D4A543_RAT SRY-box transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Sox2 PE=4 SV=1
16	Q60I23	1.82e-35	129	319	0.353	0.226	Q60I23_MOUSE SRY (sex determining region Y)-box 2 OS=Mus musculus OX=10090 GN=Sox2 PE=1 SV=1
17	P48432	1.92e-35	129	319	0.353	0.226	SOX2_MOUSE Transcription factor SOX-2 OS=Mus musculus OX=10090 GN=Sox2 PE=1 SV=2
18	P53784	2.01e-35	130	375	0.279	0.152	SOX3_MOUSE Transcription factor SOX-3 OS=Mus musculus OX=10090 GN=Sox3 PE=1 SV=2
19	A0A0U3FYV6	2.09e-35	128	317	0.353	0.227	A0A0U3FYV6_HUMAN SRY (Sex determining region Y)-box 2 OS=Homo sapiens OX=9606 GN=SOX2 PE=4 SV=1
20	P48431	2.09e-35	128	317	0.353	0.227	SOX2_HUMAN Transcription factor SOX-2 OS=Homo sapiens OX=9606 GN=SOX2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08926 DUF1908	30	15.1	Domain of unknown function (DUF1908)
2	PF00505 HMG_box	1.5e-22	91.1	HMG (high mobility group) box
3	PF09011 HMG_box_2	6.5e-05	34.7	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000038745

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000037292	0.785	Uncharacterized protein
2	9598.ENSPTRP00000038749	0.785	Zinc finger Y-chromosomal protein
3	9598.ENSPTRP00000006039	0.774	Wilms tumor 1
4	9598.ENSPTRP00000030631	0.772	POU domain, class 5, transcription factor 1
5	9598.ENSPTRP00000058594	0.748	Male-specific histone demethylase that catalyzes trimethylated 'Lys-27' (H3K27me3) demethylation in histone H3. Has relatively low lysine demethylase activity.
6	9598.ENSPTRP00000034232	0.737	Uncharacterized protein
7	9598.ENSPTRP00000003036	0.708	Uncharacterized protein
8	9598.ENSPTRP00000035057	0.708	Zinc finger protein, FOG family member 2
9	9598.ENSPTRP00000017388	0.675	Uncharacterized protein
10	9598.ENSPTRP00000002902	0.671	Sulfhydryl oxidase
11	9598.ENSPTRP00000048424	0.658	Uncharacterized protein
12	9598.ENSPTRP00000026619	0.651	Forkhead box L2
13	9598.ENSPTRP00000016293	0.602	Transcriptional regulator that plays a role in chondrocytes differentiation and skeletal development. Binds to the COL2A1 promoter and activates COL2A1 expression, as part of a complex with ZNF219.
14	9598.ENSPTRP00000035458	0.596	Uncharacterized protein
15	9598.ENSPTRP00000047467	0.592	Orphan nuclear receptor. Component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. May also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency (By similarity).
16	9598.ENSPTRP00000060782	0.592	Uncharacterized protein
17	9598.ENSPTRP00000044466	0.590	Catenin (Cadherin-associated protein), beta 1, 88kDa
18	9598.ENSPTRP00000007892	0.581	Homeobox protein NANOG
19	9598.ENSPTRP00000038766	0.577	USP9Y
20	9598.ENSPTRP00000038771	0.572	ATP-dependent RNA helicase DDX3Y

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0003677	1.000	DNA binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	0.878	sequence-specific DNA binding
GO:0003690	0.805	double-stranded DNA binding
GO:1990837	0.700	sequence-specific double-stranded DNA binding
GO:0000976	0.452	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.983	regulation of cellular process
GO:0010468	0.946	regulation of gene expression
GO:0080090	0.937	regulation of primary metabolic process
GO:0031323	0.937	regulation of cellular metabolic process
GO:0006355	0.932	regulation of DNA-templated transcription
GO:0032502	0.915	developmental process
GO:0032501	0.914	multicellular organismal process
GO:2000243	0.910	positive regulation of reproductive process
GO:0048856	0.904	anatomical structure development
GO:0007275	0.893	multicellular organism development
GO:0010628	0.891	positive regulation of gene expression
GO:0045893	0.814	positive regulation of DNA-templated transcription
GO:0051239	0.801	regulation of multicellular organismal process
GO:0050793	0.771	regulation of developmental process
GO:0051240	0.753	positive regulation of multicellular organismal process
GO:0009987	0.634	cellular process
GO:0048731	0.621	system development
GO:0051094	0.550	positive regulation of developmental process
GO:0048513	0.511	animal organ development
GO:0030154	0.498	cell differentiation
GO:0048519	0.380	negative regulation of biological process
GO:0050896	0.353	response to stimulus
GO:0022414	0.347	reproductive process
GO:0048523	0.306	negative regulation of cellular process
GO:0009888	0.303	tissue development
GO:0006357	0.300	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.573	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]