StarFunc result for job id Q05086

User Input

>input (875 residues)
MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTF
LRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARI
DFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKS
LQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIR
RVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPE
YLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRN
LVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNK
KGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTC
PFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRL
EMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFW
FNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQ
SLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDY
ILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGY
TRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTS
HTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05086	1.000	1.000	0.000	875	1.000	1.000	Q05086.pdb.gz	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
2	AFDB:Q9VTH1	0.736	0.664	5.134E-66	973	0.431	0.387	Q9VTH1.pdb.gz	Q9VTH1_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Ube3a PE=1 SV=1
3	AFDB:Q5U5R9	0.594	0.662	3.793E-40	776	0.259	0.293	Q5U5R9.pdb.gz	HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens OX=9606 GN=HECTD2 PE=1 SV=2
4	AFDB:Q5GLZ8	0.633	0.529	1.961E-37	1057	0.231	0.191	Q5GLZ8.pdb.gz	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
5	AFDB:E8NHA2	0.586	0.490	4.903E-37	1062	0.211	0.174	E8NHA2.pdb.gz	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
6	AFDB:O94275	0.606	0.653	1.069E-35	807	0.242	0.263	O94275.pdb.gz	MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug30 PE=1 SV=1
7	AFDB:P40985	0.573	0.563	1.622E-35	892	0.240	0.235	P40985.pdb.gz	HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL4 PE=1 SV=2
8	AFDB:Q9UII4	0.567	0.493	4.306E-33	1024	0.198	0.169	Q9UII4.pdb.gz	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
9	AFDB:Q8IVU3	0.572	0.496	4.680E-33	1022	0.197	0.168	Q8IVU3.pdb.gz	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
10	AFDB:F2Z461	0.541	0.478	5.939E-32	1003	0.199	0.173	F2Z461.pdb.gz	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
11	PDB:7jq9A	0.260	0.108	1.975E-21	2427	0.190	0.068	7jq9A.pdb.gz
12	PDB:7mopA	0.245	0.095	6.892E-21	2445	0.177	0.063	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:6zwmB	0.068	0.042	2.095E-1	2185	0.080	0.032	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
14	PDB:7sx3E	0.114	0.077	2.475E-1	1611	0.074	0.040	7sx3E.pdb.gz	Structural architecture of the human NALCN channelosome.
15	PDB:4jlqA	0.105	0.109	3.453E-1	840	0.089	0.093	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:7lt3C	0.123	0.044	3.913E-1	3720	0.087	0.020	7lt3C.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
17	PDB:4hm9A	0.116	0.171	4.253E-1	511	0.087	0.149	4hm9A.pdb.gz
18	PDB:6kwyc	0.092	0.061	4.434E-1	1811	0.070	0.034	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.
19	PDB:1qgkA	0.079	0.079	5.024E-1	876	0.078	0.078	1qgkA.pdb.gz
20	PDB:7ajlAAA	0.067	0.143	5.238E-1	290	0.038	0.114	7ajlAAA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTH7	0.0	1460	760	0.837	0.963	A0A0G2JTH7_RAT Ubiquitin protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2
2	A0A8I5ZM14	0.0	1693	867	0.935	0.943	A0A8I5ZM14_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=1
3	F1M7B8	0.0	1667	868	0.950	0.957	F1M7B8_RAT Ubiquitin-protein ligase E3A OS=Rattus norvegicus OX=10116 GN=Ube3a PE=1 SV=2
4	O08759	0.0	1661	870	0.947	0.953	UBE3A_MOUSE Ubiquitin-protein ligase E3A OS=Mus musculus OX=10090 GN=Ube3a PE=1 SV=2
5	Q05086	0.0	1813	875	1.000	1.000	UBE3A_HUMAN Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4
6	Q9VTH1	0.0	639	973	0.453	0.407	Q9VTH1_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Ube3a PE=1 SV=1
7	Q5U5R9	1.64e-107	351	776	0.210	0.237	HECD2_HUMAN Probable E3 ubiquitin-protein ligase HECTD2 OS=Homo sapiens OX=9606 GN=HECTD2 PE=1 SV=2
8	Q6PAV2	1.55e-85	297	1057	0.193	0.160	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
9	E8NHA2	2.36e-82	288	1062	0.194	0.160	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
10	Q5GLZ8	5.36e-80	281	1057	0.191	0.158	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
11	O94275	8.36e-73	257	807	0.174	0.188	MUG30_SCHPO Probable E3 ubiquitin-protein ligase mug30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug30 PE=1 SV=1
12	P40985	6.74e-67	242	892	0.192	0.188	HUL4_YEAST Probable E3 ubiquitin-protein ligase HUL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUL4 PE=1 SV=2
13	Q9UII4	6.44e-62	229	1024	0.159	0.136	HERC5_HUMAN E3 ISG15--protein ligase HERC5 OS=Homo sapiens OX=9606 GN=HERC5 PE=1 SV=2
14	Q8H0T4	1.50e-60	227	3658	0.175	0.042	UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana OX=3702 GN=UPL2 PE=1 SV=3
15	Q8GY23	6.29e-60	225	3681	0.168	0.040	UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana OX=3702 GN=UPL1 PE=1 SV=3
16	Q8IVU3	2.84e-59	221	1022	0.168	0.144	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
17	O14326	3.42e-57	213	786	0.160	0.178	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
18	O00308	1.06e-56	212	870	0.145	0.146	WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2 PE=1 SV=2
19	Q5U1Z5	1.30e-56	203	440	0.145	0.289	Q5U1Z5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=2 SV=1
20	Q9DBH0	1.97e-56	211	870	0.146	0.147	WWP2_MOUSE NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus OX=10090 GN=Wwp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16558 AZUL	6.2e-14	63.3	Amino-terminal Zinc-binding domain of ubiquitin ligase E3A
2	PF00632 HECT	6.2e-89	310.1	HECT-domain (ubiquitin-transferase)
3	PF15717 PCM1_C	7.7e+02	10.2	Pericentriolar material 1 C terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000001793

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011861	0.996	Cellular tumor antigen p53
2	61853.ENSNLEP00000012370	0.973	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
3	61853.ENSNLEP00000015737	0.932	RAD23 homolog A, nucleotide excision repair protein
4	61853.ENSNLEP00000014947	0.926	Ubiquitin-conjugating enzyme E2D 1
5	61853.ENSNLEP00000002540	0.907	Discs, large homolog 1 (Drosophila)
6	61853.ENSNLEP00000006239	0.891	Nuclear transcription factor, X-box binding 1
7	61853.ENSNLEP00000000229	0.885	Belongs to the ubiquitin-conjugating enzyme family.
8	61853.ENSNLEP00000022536	0.885	Ubiquitin conjugating enzyme E2 L5, pseudogene
9	61853.ENSNLEP00000011129	0.881	Tuberous sclerosis 2
10	61853.ENSNLEP00000015722	0.879	Tuberous sclerosis 1
11	61853.ENSNLEP00000006991	0.878	Catenin beta 1
12	61853.ENSNLEP00000019977	0.860	Discs, large homolog 2 (Drosophila)
13	61853.ENSNLEP00000014741	0.857	Tumor suppressor. Acts as a dual-specificity protein phosphatase, dephosphorylating tyrosine-, serine- and threonine- phosphorylated proteins. Also acts as a lipid phosphatase.
14	61853.ENSNLEP00000001169	0.853	Discs, large homolog 3 (Drosophila)
15	61853.ENSNLEP00000018128	0.848	PATJ, crumbs cell polarity complex component
16	61853.ENSNLEP00000002428	0.828	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
17	61853.ENSNLEP00000020685	0.826	Proteasome (prosome, macropain) 26S subunit, ATPase, 1
18	61853.ENSNLEP00000000670	0.819	Membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)
19	61853.ENSNLEP00000023523	0.816	Uncharacterized protein
20	61853.ENSNLEP00000014504	0.811	Membrane associated guanylate kinase, WW and PDZ domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0071495	0.988	cellular response to endogenous stimulus
GO:0014070	0.988	response to organic cyclic compound
GO:0048518	0.985	positive regulation of biological process
GO:0032501	0.972	multicellular organismal process
GO:0009987	0.972	cellular process
GO:1901700	0.969	response to oxygen-containing compound
GO:0071704	0.963	organic substance metabolic process
GO:0006807	0.959	nitrogen compound metabolic process
GO:0048523	0.956	negative regulation of cellular process
GO:1990089	0.945	response to nerve growth factor
GO:1901564	0.940	organonitrogen compound metabolic process
GO:0044238	0.932	primary metabolic process
GO:0043170	0.918	macromolecule metabolic process
GO:0070647	0.909	protein modification by small protein conjugation or removal
GO:1901698	0.899	response to nitrogen compound
GO:0051128	0.890	regulation of cellular component organization
GO:0043279	0.890	response to alkaloid
GO:0032446	0.876	protein modification by small protein conjugation
GO:0006950	0.869	response to stress
GO:0007610	0.859	behavior
GO:0060998	0.852	regulation of dendritic spine development
GO:0035640	0.844	exploration behavior
GO:0065008	0.837	regulation of biological quality
GO:0019222	0.812	regulation of metabolic process
GO:0044237	0.800	cellular metabolic process
GO:0060255	0.773	regulation of macromolecule metabolic process
GO:0080090	0.770	regulation of primary metabolic process
GO:0051171	0.770	regulation of nitrogen compound metabolic process
GO:0051716	0.763	cellular response to stimulus
GO:0016567	0.724	protein ubiquitination
GO:0031323	0.689	regulation of cellular metabolic process
GO:0050807	0.680	regulation of synapse organization
GO:0019725	0.664	cellular homeostasis
GO:0050890	0.652	cognition
GO:0009893	0.650	positive regulation of metabolic process
GO:0007154	0.646	cell communication
GO:0010604	0.642	positive regulation of macromolecule metabolic process
GO:0051246	0.635	regulation of protein metabolic process
GO:0099175	0.633	regulation of postsynapse organization
GO:1990090	0.631	cellular response to nerve growth factor stimulus
GO:0042220	0.627	response to cocaine
GO:0007626	0.614	locomotory behavior
GO:0007611	0.614	learning or memory
GO:0006508	0.607	proteolysis
GO:0070887	0.606	cellular response to chemical stimulus
GO:0022603	0.603	regulation of anatomical structure morphogenesis
GO:0071310	0.600	cellular response to organic substance
GO:0007612	0.600	learning
GO:0120035	0.571	regulation of plasma membrane bounded cell projection organization
GO:0061001	0.557	regulation of dendritic spine morphogenesis
GO:0051093	0.549	negative regulation of developmental process
GO:0051173	0.543	positive regulation of nitrogen compound metabolic process
GO:0048878	0.540	chemical homeostasis
GO:0042542	0.540	response to hydrogen peroxide
GO:0010977	0.540	negative regulation of neuron projection development
GO:0007165	0.536	signal transduction
GO:0009056	0.518	catabolic process
GO:0048522	0.480	positive regulation of cellular process
GO:0044260	0.478	cellular macromolecule metabolic process
GO:0009057	0.471	macromolecule catabolic process
GO:0071407	0.451	cellular response to organic cyclic compound
GO:0044248	0.407	cellular catabolic process
GO:0010468	0.396	regulation of gene expression
GO:0048583	0.395	regulation of response to stimulus
GO:0051247	0.369	positive regulation of protein metabolic process
GO:0071840	0.364	cellular component organization or biogenesis
GO:0019219	0.358	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.357	regulation of cellular biosynthetic process
GO:0043632	0.351	modification-dependent macromolecule catabolic process
GO:0010556	0.349	regulation of macromolecule biosynthetic process
GO:0006511	0.341	ubiquitin-dependent protein catabolic process
GO:0010646	0.335	regulation of cell communication
GO:0031399	0.334	regulation of protein modification process
GO:0023051	0.316	regulation of signaling
GO:0030522	0.304	intracellular receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0031974	0.976	membrane-enclosed lumen
GO:0005654	0.972	nucleoplasm
GO:0030054	0.641	cell junction
GO:0045202	0.374	synapse
GO:0032991	0.353	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]