StarFunc result for job id Q05195

User Input

>input (221 residues)
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRST
HNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQID
QLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSS
SSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05195	1.000	1.000	9.670E-34	221	1.000	1.000	Q05195.pdb.gz	MAD1_HUMAN Max dimerization protein 1 OS=Homo sapiens OX=9606 GN=MXD1 PE=1 SV=1
2	AFDB:P50538	0.453	0.442	2.159E-27	227	0.882	0.859	P50538.pdb.gz	MAD1_MOUSE Max dimerization protein 1 OS=Mus musculus OX=10090 GN=Mxd1 PE=1 SV=2
3	AFDB:O09015	0.393	0.382	1.023E-17	228	0.584	0.566	O09015.pdb.gz	MXI1_RAT Max-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mxi1 PE=2 SV=1
4	AFDB:Q14582	0.400	0.420	9.346E-15	209	0.480	0.507	Q14582.pdb.gz	MAD4_HUMAN Max dimerization protein 4 OS=Homo sapiens OX=9606 GN=MXD4 PE=1 SV=2
5	AFDB:Q9BW11	0.432	0.460	9.160E-12	206	0.407	0.437	Q9BW11.pdb.gz	MAD3_HUMAN Max dimerization protein 3 OS=Homo sapiens OX=9606 GN=MXD3 PE=1 SV=1
6	AFDB:Q80US8	0.439	0.467	1.984E-11	206	0.407	0.437	Q80US8.pdb.gz	MAD3_MOUSE Max dimerization protein 3 OS=Mus musculus OX=10090 GN=Mxd3 PE=1 SV=1
7	AFDB:F6U3F6	0.340	0.333	5.888E-9	226	0.398	0.389	F6U3F6.pdb.gz	F6U3F6_HUMAN MAX interactor 1, dimerization protein (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=1
8	AFDB:O08789	0.385	0.153	3.117E-5	591	0.213	0.080	O08789.pdb.gz	MNT_MOUSE Max-binding protein MNT OS=Mus musculus OX=10090 GN=Mnt PE=2 SV=2
9	AFDB:G5EG44	0.395	0.317	5.470E-5	281	0.199	0.157	G5EG44.pdb.gz	MDL1_CAEEL Mad-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=mdl-1 PE=1 SV=1
10	AFDB:M9NDN0	0.394	0.161	1.463E-4	583	0.172	0.065	M9NDN0.pdb.gz	M9NDN0_DROME Mnt, isoform J OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
11	PDB:3ojaA	0.300	0.163	5.731E-1	482	0.104	0.048	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:7suk6	0.136	0.115	1.079	277	0.118	0.094	7suk6.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
13	PDB:7mqaSS	0.102	0.069	1.764	350	0.127	0.080	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:3v9rA	0.112	0.246	3.096	88	0.050	0.125	3v9rA.pdb.gz
15	PDB:5jk7F	0.115	0.288	5.432	74	0.045	0.135	5jk7F.pdb.gz
16	PDB:4n78F	0.158	0.209	5.828	156	0.059	0.083	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
17	PDB:5jeaK	0.103	0.121	6.252	185	0.077	0.092	5jeaK.pdb.gz	Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
18	PDB:5mqfK	0.148	0.172	6.252	191	0.118	0.136	5mqfK.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
19	PDB:7vciU	0.179	0.070	6.252	820	0.100	0.027	7vciU.pdb.gz
20	PDB:7c79B	0.116	0.039	7.195	793	0.077	0.021	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05195	4.02e-161	445	221	1.000	1.000	MAD1_HUMAN Max dimerization protein 1 OS=Homo sapiens OX=9606 GN=MXD1 PE=1 SV=1
2	P50538	1.34e-132	374	227	0.887	0.863	MAD1_MOUSE Max dimerization protein 1 OS=Mus musculus OX=10090 GN=Mxd1 PE=1 SV=2
3	C9JBE8	1.50e-128	362	181	0.819	1.000	C9JBE8_HUMAN MAX dimerization protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=MXD1 PE=1 SV=1
4	O09015	5.64e-83	248	228	0.584	0.566	MXI1_RAT Max-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mxi1 PE=2 SV=1
5	P50540	6.36e-83	248	228	0.602	0.583	MXI1_MOUSE Max-interacting protein 1 OS=Mus musculus OX=10090 GN=Mxi1 PE=1 SV=1
6	P50539	1.13e-80	242	228	0.579	0.561	MXI1_HUMAN Max-interacting protein 1 OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=2
7	B1ANN8	5.12e-75	228	218	0.548	0.555	B1ANN8_HUMAN MAX interactor 1, dimerization protein OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=1
8	A0A0S2Z3Y0	2.52e-66	204	192	0.475	0.547	A0A0S2Z3Y0_HUMAN MAX interactor 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=2 SV=1
9	Q14582	4.68e-58	184	209	0.484	0.512	MAD4_HUMAN Max dimerization protein 4 OS=Homo sapiens OX=9606 GN=MXD4 PE=1 SV=2
10	Q60948	3.61e-52	169	209	0.452	0.478	MAD4_MOUSE Max dimerization protein 4 OS=Mus musculus OX=10090 GN=Mxd4 PE=1 SV=1
11	F6U3F6	1.90e-46	155	226	0.394	0.385	F6U3F6_HUMAN MAX interactor 1, dimerization protein (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=1
12	Q9BW11	1.05e-42	145	206	0.398	0.427	MAD3_HUMAN Max dimerization protein 3 OS=Homo sapiens OX=9606 GN=MXD3 PE=1 SV=1
13	Q80US8	6.28e-34	122	206	0.376	0.403	MAD3_MOUSE Max dimerization protein 3 OS=Mus musculus OX=10090 GN=Mxd3 PE=1 SV=1
14	F6WCI9	1.14e-33	119	118	0.267	0.500	F6WCI9_HUMAN MAX interactor 1, dimerization protein (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=1
15	G5EG44	2.48e-15	75.1	281	0.176	0.139	MDL1_CAEEL Mad-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=mdl-1 PE=1 SV=1
16	X2JDM5	1.21e-09	59.7	716	0.145	0.045	X2JDM5_DROME Mnt, isoform K OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
17	E1JJE8	1.24e-09	59.7	789	0.145	0.041	E1JJE8_DROME Mnt, isoform F OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
18	Q9W4Q7	1.25e-09	59.7	790	0.145	0.041	Q9W4Q7_DROME Mnt, isoform D OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=3
19	M9NGP0	1.33e-09	59.7	790	0.145	0.041	M9NGP0_DROME Mnt, isoform I OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
20	O46042	7.98e-08	54.3	582	0.145	0.055	O46042_DROME EG:114E2.2 protein OS=Drosophila melanogaster OX=7227 GN=Mnt PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1.2e-08	46.1	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264444

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351490	0.999	Protein max
2	9606.ENSP00000378402	0.998	Paired amphipathic helix protein Sin3a
3	9606.ENSP00000369131	0.967	Paired amphipathic helix protein Sin3b
4	9606.ENSP00000430432	0.955	Histone deacetylase 2
5	9606.ENSP00000296504	0.951	Histone deacetylase complex subunit SAP30
6	9606.ENSP00000362649	0.938	Histone deacetylase 1
7	9606.ENSP00000481842	0.925	Histone deacetylase complex subunit SAP18
8	9606.ENSP00000309572	0.913	Telomerase reverse transcriptase
9	9606.ENSP00000362592	0.908	Histone-binding protein RBBP4
10	9606.ENSP00000369424	0.906	Histone-binding protein RBBP7
11	9606.ENSP00000174618	0.785	Max-binding protein MNT
12	9606.ENSP00000443988	0.744	Sin3 histone deacetylase corepressor complex component SDS3
13	9606.ENSP00000246912	0.732	Max-like protein X
14	9606.ENSP00000312834	0.717	MLX-interacting protein
15	9606.ENSP00000258439	0.716	Transmembrane protein 127
16	9606.ENSP00000006777	0.684	Rhomboid domain containing 2
17	9606.ENSP00000356234	0.674	Lysine-specific demethylase 5B
18	9606.ENSP00000380494	0.650	Protein L-Myc
19	9606.ENSP00000264436	0.642	Beta-adducin
20	9606.ENSP00000479618	0.636	Myc proto-oncogene protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227	0.948	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000987	0.888	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.814	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0048519	0.982	negative regulation of biological process
GO:0010605	0.963	negative regulation of macromolecule metabolic process
GO:0048523	0.955	negative regulation of cellular process
GO:0051172	0.936	negative regulation of nitrogen compound metabolic process
GO:0031324	0.927	negative regulation of cellular metabolic process
GO:0000122	0.916	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:0005829	0.987	cytosol
GO:0043232	0.962	intracellular non-membrane-bounded organelle
GO:0140513	0.926	nuclear protein-containing complex
GO:0005667	0.909	transcription regulator complex
GO:0005739	0.857	mitochondrion
GO:0000785	0.476	chromatin
GO:0070443	0.387	Mad-Max complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]