StarFunc result for job id Q05209

User Input

>input (780 residues)
MEQVEILRKFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVK
KNRYKDILPFDHSRVKLTLKTPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRM
IWEYNVVIIVMACREFEMGRKKCERYWPLYGEDPITFAPFKISCEDEQARTDYFIRTLLL
EFQNESRRLYQFHYVNWPDHDVPSSFDSILDMISLMRKYQEHEDVPICIHCSAGCGRTGA
ICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQL
YEIHGAQKIADGVNEINTENMVSSIEPEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPH
PVPPILTPSPPSAFPTVTTVWQDNDRYHPKPVLHMVSSEQHSADLNRNYSKSTELPGKNE
STIEQIDKKLERNLSFEIKKVPLQEGPKSFDGNTLLNRGHAIKIKSASPCIADKISKPQE
LSSDLNVGDTSQNSCVDCSVTQSNKVSVTPPEESQNSDTPPRPDRLPLDEKGHVTWSFHG
PENAIPIPDLSEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNP
LHSDDSDSDERNSDGAVTQNKTNISTASATVSAATSTESISTRKVLPMSIARHNIAGTTH
SGAEKDVDVSEDSPPPLPERTPESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSE
NEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEWT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05209	1.000	1.000	0.000	780	1.000	1.000	Q05209.pdb.gz	PTN12_HUMAN Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3
2	AFDB:P35831	0.555	0.559	4.041E-97	775	0.838	0.844	P35831.pdb.gz	PTN12_MOUSE Tyrosine-protein phosphatase non-receptor type 12 OS=Mus musculus OX=10090 GN=Ptpn12 PE=1 SV=3
3	AFDB:P29352	0.408	0.398	2.700E-49	802	0.356	0.347	P29352.pdb.gz	PTN22_MOUSE Tyrosine-protein phosphatase non-receptor type 22 OS=Mus musculus OX=10090 GN=Ptpn22 PE=1 SV=1
4	AFDB:Q9Y2R2	0.384	0.372	2.801E-48	807	0.351	0.340	Q9Y2R2.pdb.gz	PTN22_HUMAN Tyrosine-protein phosphatase non-receptor type 22 OS=Homo sapiens OX=9606 GN=PTPN22 PE=1 SV=2
5	AFDB:D4A2D5	0.421	0.409	2.592E-47	804	0.347	0.337	D4A2D5.pdb.gz	D4A2D5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn22 PE=1 SV=1
6	PDB:3ps5A	0.347	0.504	1.297E-26	529	0.142	0.210	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
7	PDB:4gwfA	0.313	0.485	4.298E-26	497	0.145	0.227	4gwfA.pdb.gz
8	PDB:5xzrA	0.358	0.532	7.889E-25	519	0.141	0.212	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
9	PDB:6krwA	0.337	0.828	1.623E-23	306	0.112	0.284	6krwA.pdb.gz
10	PDB:3m4uA	0.304	0.792	3.451E-18	285	0.104	0.284	3m4uA.pdb.gz
11	AFDB:Q9H3S7	0.333	0.164	3.306E-14	1636	0.151	0.072	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
12	AFDB:Q6PB44	0.340	0.160	1.601E-12	1692	0.137	0.063	Q6PB44.pdb.gz	PTN23_MOUSE Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus OX=10090 GN=Ptpn23 PE=1 SV=2
13	AFDB:A0A286YBL8	0.303	0.201	2.426E-10	1204	0.112	0.072	A0A286YBL8.pdb.gz	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
14	AFDB:Q62130	0.299	0.201	1.394E-8	1189	0.108	0.071	Q62130.pdb.gz	PTN14_MOUSE Tyrosine-protein phosphatase non-receptor type 14 OS=Mus musculus OX=10090 GN=Ptpn14 PE=1 SV=2
15	AFDB:F1Q6T9	0.304	0.207	4.122E-8	1168	0.113	0.075	F1Q6T9.pdb.gz	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
16	PDB:5bx1A	0.142	0.599	1.914E-3	153	0.047	0.242	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
17	PDB:4ercA	0.159	0.685	2.695E-3	150	0.042	0.220	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
18	PDB:3s4oA	0.139	0.566	3.386E-3	163	0.038	0.184	3s4oA.pdb.gz
19	PDB:7jvxA	0.163	0.370	4.504E-3	314	0.049	0.121	7jvxA.pdb.gz
20	PDB:5xjvB	0.145	0.521	9.456E-3	171	0.026	0.117	5xjvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KAC5	0.0	715	415	0.455	0.855	A0A0G2KAC5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn12 PE=1 SV=1
2	A0A8I5ZN71	0.0	1238	763	0.819	0.837	A0A8I5ZN71_RAT Tyrosine-protein phosphatase non-receptor type 12 OS=Rattus norvegicus OX=10116 GN=Ptpn12 PE=1 SV=1
3	G3V7Q4	0.0	1281	766	0.838	0.854	G3V7Q4_RAT Tyrosine-protein phosphatase non-receptor type 12 OS=Rattus norvegicus OX=10116 GN=Ptpn12 PE=1 SV=1
4	P35831	0.0	1290	775	0.838	0.844	PTN12_MOUSE Tyrosine-protein phosphatase non-receptor type 12 OS=Mus musculus OX=10090 GN=Ptpn12 PE=1 SV=3
5	Q05209	0.0	1622	780	1.000	1.000	PTN12_HUMAN Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3
6	Q63745	0.0	778	382	0.472	0.963	Q63745_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn12 PE=1 SV=1
7	Q9Y2R2	6.68e-137	426	807	0.244	0.235	PTN22_HUMAN Tyrosine-protein phosphatase non-receptor type 22 OS=Homo sapiens OX=9606 GN=PTPN22 PE=1 SV=2
8	P29352	4.38e-135	421	802	0.242	0.236	PTN22_MOUSE Tyrosine-protein phosphatase non-receptor type 22 OS=Mus musculus OX=10090 GN=Ptpn22 PE=1 SV=1
9	D4A2D5	1.89e-133	417	804	0.237	0.230	D4A2D5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn22 PE=1 SV=1
10	A0A8I6A706	2.84e-133	416	803	0.237	0.230	A0A8I6A706_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn22 PE=3 SV=1
11	P70602	4.04e-93	300	453	0.179	0.309	P70602_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn18 PE=1 SV=1
12	Q61152	1.38e-88	288	453	0.169	0.291	PTN18_MOUSE Tyrosine-protein phosphatase non-receptor type 18 OS=Mus musculus OX=10090 GN=Ptpn18 PE=1 SV=1
13	Q99952	2.03e-87	285	460	0.171	0.289	PTN18_HUMAN Tyrosine-protein phosphatase non-receptor type 18 OS=Homo sapiens OX=9606 GN=PTPN18 PE=1 SV=2
14	Q95Y26	1.55e-56	202	469	0.141	0.235	Q95Y26_CAEEL Protein-tyrosine-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ptpn-22 PE=1 SV=2
15	F1LXJ9	1.25e-53	204	1454	0.131	0.070	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
16	Q99M80	1.39e-53	204	1454	0.131	0.070	PTPRT_MOUSE Receptor-type tyrosine-protein phosphatase T OS=Mus musculus OX=10090 GN=Ptprt PE=1 SV=2
17	O14522	1.73e-53	203	1441	0.131	0.071	PTPRT_HUMAN Receptor-type tyrosine-protein phosphatase T OS=Homo sapiens OX=9606 GN=PTPRT PE=1 SV=6
18	P29350	3.71e-52	193	595	0.145	0.190	PTN6_HUMAN Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6 PE=1 SV=1
19	Q53XS4	4.06e-52	193	597	0.145	0.189	Q53XS4_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN6 PE=2 SV=1
20	P28828	6.62e-52	198	1452	0.119	0.064	PTPRM_MOUSE Receptor-type tyrosine-protein phosphatase mu OS=Mus musculus OX=10090 GN=Ptprm PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	43	15.4	Dual specificity phosphatase, catalytic domain
2	PF14566 PTPlike_phytase	2.5e+02	13.2	Inositol hexakisphosphate
3	PF00102 Y_phosphatase	8.1e-77	269.5	Protein-tyrosine phosphatase
4	PF13350 Y_phosphatase3	0.54	21.8	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000248594

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452746	0.999	Proline-serine-threonine phosphatase-interacting protein 1
2	9606.ENSP00000267257	0.997	Paxillin
3	9606.ENSP00000401303	0.997	SHC-transforming protein 1
4	9606.ENSP00000391669	0.994	Breast cancer anti-estrogen resistance protein 1
5	9606.ENSP00000275493	0.984	Epidermal growth factor receptor
6	9606.ENSP00000261799	0.965	Platelet-derived growth factor receptor beta
7	9606.ENSP00000269571	0.962	Receptor tyrosine-protein kinase erbB-2
8	9606.ENSP00000391592	0.935	Tyrosine-protein phosphatase non-receptor type 6
9	9606.ENSP00000355923	0.931	Tyrosine-protein phosphatase non-receptor type 14
10	9606.ENSP00000394794	0.927	Tyrosine-protein phosphatase non-receptor type 13
11	9606.ENSP00000263708	0.926	Tyrosine-protein phosphatase non-receptor type 4
12	9606.ENSP00000267101	0.926	Receptor tyrosine-protein kinase erbB-3
13	9606.ENSP00000340944	0.924	Tyrosine-protein phosphatase non-receptor type 11
14	9606.ENSP00000342235	0.923	Receptor tyrosine-protein kinase erbB-4
15	9606.ENSP00000265171	0.921	Pro-epidermal growth factor
16	9606.ENSP00000311857	0.917	Tyrosine-protein phosphatase non-receptor type 2
17	9606.ENSP00000482732	0.917	Tyrosine-protein phosphatase non-receptor type 9
18	9606.ENSP00000309116	0.916	Tyrosine-protein phosphatase non-receptor type 7
19	9606.ENSP00000365891	0.916	Wiskott-Aldrich syndrome protein
20	9606.ENSP00000384620	0.914	Pro-neuregulin-1, membrane-bound isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0019904	0.853	protein domain specific binding
GO:0017124	0.834	SH3 domain binding
GO:0004726	0.781	non-membrane spanning protein tyrosine phosphatase activity
GO:0019899	0.319	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050896	0.983	response to stimulus
GO:0050794	0.982	regulation of cellular process
GO:0071704	0.978	organic substance metabolic process
GO:0048583	0.951	regulation of response to stimulus
GO:0044238	0.949	primary metabolic process
GO:0044237	0.949	cellular metabolic process
GO:0006470	0.940	protein dephosphorylation
GO:0048519	0.930	negative regulation of biological process
GO:0051716	0.784	cellular response to stimulus
GO:0070848	0.775	response to growth factor
GO:0009966	0.763	regulation of signal transduction
GO:0048523	0.761	negative regulation of cellular process
GO:0071363	0.754	cellular response to growth factor stimulus
GO:0048585	0.662	negative regulation of response to stimulus
GO:1901184	0.658	regulation of ERBB signaling pathway
GO:0009968	0.635	negative regulation of signal transduction
GO:0019222	0.553	regulation of metabolic process
GO:0070849	0.514	response to epidermal growth factor
GO:0007154	0.513	cell communication
GO:0048518	0.492	positive regulation of biological process
GO:0023052	0.485	signaling
GO:0048522	0.481	positive regulation of cellular process
GO:0007165	0.450	signal transduction
GO:0071364	0.449	cellular response to epidermal growth factor stimulus
GO:1901185	0.449	negative regulation of ERBB signaling pathway
GO:0060255	0.413	regulation of macromolecule metabolic process
GO:0031323	0.409	regulation of cellular metabolic process
GO:0032502	0.376	developmental process
GO:0048856	0.371	anatomical structure development
GO:0080090	0.338	regulation of primary metabolic process
GO:0042221	0.330	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.998	nucleus
GO:0005654	0.988	nucleoplasm
GO:0071944	0.963	cell periphery
GO:0016020	0.960	membrane
GO:0005886	0.951	plasma membrane
GO:0043232	0.404	intracellular non-membrane-bounded organelle
GO:0005856	0.330	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]