StarFunc result for job id Q05215

User Input

>input (589 residues)
MAVARGVGSPEPAPPQLYKWGGCGLGEPGSALERRGAAARGRCGRARAPRLPDSFPRGEC
PKPGARAPRSVRCGEPLPPASPPPARPQAQRARPRAPHSRRRAMLHLSEFSEPDALLVKS
TEGCCAEPSAELPRLPARDAPAATGYPGAGDFLSWALNSCGASGDLADSCFLEGPAPTPP
PGLSYSGSFFIQAVPEHPHDPEALFNLMSGILGLAPFPGPEAAASRSPLDAPFPAGSDAL
LPGPPDLYSPDLGAAPFPEAFWEASPCAGAPSQCLYEPQLSPPDVKPGLRAPPASPALDA
VSAFKGPYAPWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPA
NRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLR
SAAAADFPKPLVADIPGSSGVAAPPVPPPPPTPFPQAKARRKGRRGGKCSTRCFCPRPHA
KAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKP
FACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGFYSLGLSFASL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05215	0.999	0.999	3.955E-86	589	1.000	1.000	Q05215.pdb.gz	EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens OX=9606 GN=EGR4 PE=1 SV=3
2	AFDB:Q9VI93	0.128	0.080	7.763E-9	946	0.170	0.106	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
3	AFDB:Q5BIH1	0.156	0.116	1.477E-8	803	0.214	0.157	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
4	AFDB:B9WEF9	0.166	0.141	4.704E-8	708	0.171	0.143	B9WEF9.pdb.gz	B9WEF9_CANDC Transcriptional regulator, putative OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) OX=573826 GN=CRZ1 PE=4 SV=1
5	AFDB:Q5B154	0.149	0.124	6.489E-8	730	0.192	0.155	Q5B154.pdb.gz	Q5B154_EMENI C2H2-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05726 PE=4 SV=1
6	AFDB:Q9VEW6	0.139	0.090	8.394E-8	924	0.182	0.116	Q9VEW6.pdb.gz	Q9VEW6_DROME IP01015p OS=Drosophila melanogaster OX=7227 GN=pad PE=2 SV=2
7	AFDB:Q09838	0.152	0.133	1.086E-7	681	0.192	0.166	Q09838.pdb.gz	PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prz1 PE=1 SV=1
8	AFDB:Q4WJ81	0.138	0.112	1.317E-7	754	0.222	0.174	Q4WJ81.pdb.gz	CRZA_ASPFU C2H2 finger domain transcription factor crzA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=crzA PE=1 SV=1
9	AFDB:Q02446	0.148	0.112	1.597E-7	784	0.202	0.152	Q02446.pdb.gz	SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens OX=9606 GN=SP4 PE=1 SV=2
10	AFDB:O15209	0.139	0.130	1.817E-7	634	0.163	0.151	O15209.pdb.gz	ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZBTB22 PE=1 SV=1
11	PDB:7o4iW	0.046	0.076	1.339	312	0.024	0.045	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
12	PDB:6cp37	0.055	0.137	4.265	171	0.025	0.088	6cp37.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.
13	PDB:6vk0C	0.051	0.121	5.517	180	0.010	0.033	6vk0C.pdb.gz
14	PDB:5gm6a	0.029	0.100	6.691	123	0.015	0.073	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:4r8pL	0.035	0.073	7.610	254	0.014	0.031	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
16	PDB:7dvqM	0.027	0.069	8.655	191	0.025	0.079	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:4v6wCW	0.054	0.210	9.844	130	0.025	0.115	4v6wCW.pdb.gz	Structures of the human and Drosophila 80S ribosome.
18	PDB:6xywBn	0.056	0.255	9.844	100	0.029	0.170	6xywBn.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00911	0.0	776	478	0.706	0.870	EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus OX=10116 GN=Egr4 PE=2 SV=1
2	Q05215	0.0	1147	589	1.000	1.000	EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens OX=9606 GN=EGR4 PE=1 SV=3
3	A0MWD2	2.90e-49	180	510	0.124	0.143	A0MWD2_TAEGU Early growth response protein OS=Taeniopygia guttata OX=59729 GN=zenk PE=2 SV=1
4	J7JV33	2.96e-49	180	510	0.124	0.143	J7JV33_TAEGU Early growth response protein OS=Taeniopygia guttata OX=59729 GN=Egr1 PE=2 SV=1
5	Q8QG62	5.53e-49	179	510	0.124	0.143	Q8QG62_CHICK Early growth response protein OS=Gallus gallus OX=9031 GN=EGR1 PE=2 SV=1
6	Q5ZLU9	5.70e-49	179	510	0.124	0.143	Q5ZLU9_CHICK Early growth response protein OS=Gallus gallus OX=9031 GN=RCJMB04_4l24 PE=2 SV=1
7	P18146	1.11e-48	179	543	0.122	0.133	EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens OX=9606 GN=EGR1 PE=1 SV=1
8	Q546S1	1.11e-48	179	543	0.122	0.133	Q546S1_HUMAN Early growth response protein OS=Homo sapiens OX=9606 GN=EGR1 PE=3 SV=1
9	P08046	1.16e-48	179	533	0.122	0.135	EGR1_MOUSE Early growth response protein 1 OS=Mus musculus OX=10090 GN=Egr1 PE=1 SV=2
10	P08154	1.36e-48	178	508	0.122	0.142	EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus OX=10116 GN=Egr1 PE=1 SV=2
11	A0A0H2UHR3	1.53e-48	179	536	0.122	0.134	A0A0H2UHR3_RAT Early growth response protein OS=Rattus norvegicus OX=10116 GN=Egr1 PE=3 SV=1
12	P26632	3.45e-48	177	511	0.119	0.137	EGR1_DANRE Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2
13	A0A0S2Z3U4	1.58e-46	164	201	0.119	0.348	A0A0S2Z3U4_HUMAN Early growth response 2 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=1
14	Q26452	2.09e-46	172	512	0.121	0.139	Q26452_DROSP Sr protein (Fragment) OS=Drosophila sp. OX=7242 PE=2 SV=1
15	P43300	4.45e-46	169	387	0.121	0.183	EGR3_MOUSE Early growth response protein 3 OS=Mus musculus OX=10090 GN=Egr3 PE=2 SV=2
16	E1JIP0	6.53e-46	174	717	0.122	0.100	E1JIP0_DROME FI18283p1 OS=Drosophila melanogaster OX=7227 GN=sr PE=2 SV=1
17	Q06889	7.03e-46	168	387	0.121	0.183	EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens OX=9606 GN=EGR3 PE=2 SV=1
18	A0A0B4KGW2	8.62e-46	176	1271	0.122	0.057	A0A0B4KGW2_DROME Stripe, isoform D OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
19	Q9VED3	9.72e-46	176	1186	0.122	0.061	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
20	Q7JP26	9.87e-46	176	1180	0.122	0.061	Q7JP26_DROME Stripe a protein OS=Drosophila melanogaster OX=7227 GN=sr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	7.7e-09	46.7	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	2.1e-07	42.2	C2H2-type zinc finger
3	PF13912 zf-C2H2_6	5.1	18.5	C2H2-type zinc finger
4	PF15909 zf-C2H2_8	6.9e+02	12.0	C2H2-type zinc ribbon
5	PF13913 zf-C2HC_2	89	14.4	zinc-finger of a C2HC-type
6	PF13465 zf-H2C2_2	2.4e-09	48.4	Zinc-finger double domain
7	PF13909 zf-H2C2_5	34	15.6	C2H2-type zinc-finger domain
8	PF16744 zf-RING_15	4.1e+02	12.5	KIAA1045 RING finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445626

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242480	0.926	E3 SUMO-protein ligase EGR2
2	9606.ENSP00000239938	0.925	Early growth response protein 1
3	9606.ENSP00000379330	0.923	Nuclear factor of activated T-cells, cytoplasmic 2
4	9606.ENSP00000265354	0.919	Serum response factor
5	9606.ENSP00000300659	0.901	Nuclear factor of activated T-cells, cytoplasmic 3
6	9606.ENSP00000389377	0.901	Nuclear factor of activated T-cells, cytoplasmic 1
7	9606.ENSP00000483056	0.901	ETS domain-containing protein Elk-1
8	9606.ENSP00000336894	0.806	NGFI-A-binding protein 1
9	9606.ENSP00000300131	0.748	NGFI-A-binding protein 2
10	9606.ENSP00000311196	0.720	Neuronal PAS domain-containing protein 4
11	9606.ENSP00000295926	0.600	Cyclin-L1
12	9606.ENSP00000311005	0.587	Mitogen-activated protein kinase 7
13	9606.ENSP00000306245	0.575	Proto-oncogene c-Fos
14	9606.ENSP00000440864	0.559	Nuclear receptor subfamily 4 group A member 1
15	9606.ENSP00000482027	0.529	Nuclear receptor subfamily 4 group A member 3
16	9606.ENSP00000276414	0.515	Progonadoliberin-1
17	9606.ENSP00000420405	0.515	Fibrinogen silencer-binding protein
18	9606.ENSP00000245919	0.503	Protein fosB

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0001228	0.998	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.815	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.759	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.730	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0010468	0.988	regulation of gene expression
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0048522	0.972	positive regulation of cellular process
GO:0006357	0.945	regulation of transcription by RNA polymerase II
GO:0010604	0.909	positive regulation of macromolecule metabolic process
GO:0051173	0.900	positive regulation of nitrogen compound metabolic process
GO:0031325	0.869	positive regulation of cellular metabolic process
GO:0051254	0.824	positive regulation of RNA metabolic process
GO:0045893	0.790	positive regulation of DNA-templated transcription
GO:0045944	0.732	positive regulation of transcription by RNA polymerase II
GO:0050896	0.681	response to stimulus
GO:0042127	0.560	regulation of cell population proliferation
GO:0009987	0.550	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.745	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]