StarFunc result for job id Q05315

User Input

>input (142 residues)
MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGR
RVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEA
VKMVQVWRDISLTKFNVSYLKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05315	1.000	1.000	5.983E-28	142	1.000	1.000	Q05315.pdb.gz	LEG10_HUMAN Galectin-10 OS=Homo sapiens OX=9606 GN=CLC PE=1 SV=3
2	PDB:6l6aA	0.985	0.985	4.264E-26	142	0.993	0.993	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
3	AFDB:Q9UHV8	0.963	0.984	4.630E-19	139	0.535	0.547	Q9UHV8.pdb.gz	PP13_HUMAN Galactoside-binding soluble lectin 13 OS=Homo sapiens OX=9606 GN=LGALS13 PE=1 SV=1
4	PDB:5xg7A	0.947	0.968	1.335E-18	139	0.535	0.547	5xg7A.pdb.gz
5	AFDB:Q8TCE9	0.958	0.978	1.739E-18	139	0.486	0.496	Q8TCE9.pdb.gz	PPL13_HUMAN Placental protein 13-like OS=Homo sapiens OX=9606 GN=LGALS14 PE=1 SV=2
6	AFDB:A8MUM7	0.975	0.975	3.548E-18	142	0.528	0.528	A8MUM7.pdb.gz	LEG16_HUMAN Galectin-16 OS=Homo sapiens OX=9606 GN=LGALS16 PE=1 SV=2
7	PDB:6ljqA	0.925	0.938	2.063E-16	140	0.521	0.529	6ljqA.pdb.gz	Human galectin-16 has a pseudo ligand binding site and plays a role in regulating c-Rel-mediated lymphocyte activity.
8	PDB:6k2zA	0.756	0.777	4.846E-15	138	0.479	0.493	6k2zA.pdb.gz	Structure-function studies of galectin-14, an important effector molecule in embryology.
9	AFDB:Q8K419	0.866	0.388	5.932E-14	326	0.352	0.153	Q8K419.pdb.gz	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
10	PDB:3zxfB	0.857	0.881	5.805E-13	138	0.254	0.261	3zxfB.pdb.gz
11	AFDB:J3KS82	0.878	0.719	6.492E-13	175	0.282	0.229	J3KS82.pdb.gz	J3KS82_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1
12	AFDB:P56470	0.888	0.402	6.492E-13	323	0.310	0.136	P56470.pdb.gz	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
13	AFDB:Q9JL15	0.876	0.406	6.832E-13	316	0.282	0.127	Q9JL15.pdb.gz	LEG8_MOUSE Galectin-8 OS=Mus musculus OX=10090 GN=Lgals8 PE=1 SV=1
14	AFDB:O00214	0.870	0.404	1.196E-12	317	0.268	0.120	O00214.pdb.gz	LEG8_HUMAN Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4
15	AFDB:J3QR96	0.879	0.518	1.393E-12	246	0.296	0.171	J3QR96.pdb.gz	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
16	PDB:3vv1A	0.828	0.834	2.583E-9	141	0.197	0.199	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
17	PDB:5dg2B	0.785	0.846	4.084E-9	131	0.169	0.183	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.
18	PDB:1w6mA	0.777	0.820	9.705E-9	134	0.176	0.187	1w6mA.pdb.gz	Growth-Regulatory Human Galectin-1: Crystallographic Characterisation of the Structural Changes Induced by Single-Site Mutations and Their Impact on the Thermodynamics of Ligand Binding.
19	PDB:6e20B	0.775	0.823	1.190E-8	133	0.204	0.218	6e20B.pdb.gz	Structure of the zebrafish galectin-1-L2 and model of its interaction with the infectious hematopoietic necrosis virus (IHNV) envelope glycoprotein.
20	PDB:4ga9A	0.780	0.823	4.248E-8	134	0.155	0.164	4ga9A.pdb.gz	Gal-1 structure analysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05315	5.54e-106	300	142	1.000	1.000	LEG10_HUMAN Galectin-10 OS=Homo sapiens OX=9606 GN=CLC PE=1 SV=3
2	Q9UHV8	1.53e-47	152	139	0.535	0.547	PP13_HUMAN Galactoside-binding soluble lectin 13 OS=Homo sapiens OX=9606 GN=LGALS13 PE=1 SV=1
3	A8MUM7	2.59e-47	151	142	0.528	0.528	LEG16_HUMAN Galectin-16 OS=Homo sapiens OX=9606 GN=LGALS16 PE=1 SV=2
4	Q8TCE9	1.58e-44	144	139	0.486	0.496	PPL13_HUMAN Placental protein 13-like OS=Homo sapiens OX=9606 GN=LGALS14 PE=1 SV=2
5	M0R163	1.56e-31	110	123	0.366	0.423	M0R163_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS14 PE=4 SV=1
6	M0R015	1.09e-21	84.7	83	0.275	0.470	M0R015_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS13 PE=1 SV=1
7	Q8K419	2.08e-18	81.6	326	0.331	0.144	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
8	O54891	4.60e-17	77.4	301	0.324	0.153	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1
9	Q18625	7.24e-14	68.6	283	0.282	0.141	Q18625_CAEEL Galectin OS=Caenorhabditis elegans OX=6239 GN=lec-4 PE=1 SV=1
10	J3QSH0	7.26e-14	67.0	175	0.303	0.246	J3QSH0_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
11	O00214	1.45e-13	68.2	317	0.282	0.126	LEG8_HUMAN Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4
12	P56470	1.69e-13	67.8	323	0.310	0.136	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
13	J3KT17	4.09e-13	65.9	234	0.303	0.184	J3KT17_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
14	Q9JL15	5.01e-13	66.6	316	0.282	0.127	LEG8_MOUSE Galectin-8 OS=Mus musculus OX=10090 GN=Lgals8 PE=1 SV=1
15	J3QR96	9.33e-13	65.1	246	0.303	0.175	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
16	J3KSY2	9.60e-13	65.9	323	0.303	0.133	J3KSY2_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
17	Q6DKI2	1.92e-12	65.1	356	0.303	0.121	LEG9C_HUMAN Galectin-9C OS=Homo sapiens OX=9606 GN=LGALS9C PE=1 SV=2
18	G5EGB1	4.36e-12	63.5	278	0.289	0.147	G5EGB1_CAEEL Galectin OS=Caenorhabditis elegans OX=6239 GN=lec-2 PE=1 SV=1
19	J3KS82	1.28e-11	60.8	175	0.289	0.234	J3KS82_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1
20	P47929	4.00e-11	58.9	136	0.261	0.272	LEG7_HUMAN Galectin-7 OS=Homo sapiens OX=9606 GN=LGALS7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00337 Gal-bind_lectin	1.1e-28	110.9	Galactoside-binding lectin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221804

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483375	0.900	UDP-glucose 4-epimerase
2	9606.ENSP00000303276	0.694	Non-secretory ribonuclease
3	9606.ENSP00000254301	0.692	Galectin-3
4	9606.ENSP00000302324	0.682	Eosinophil cationic protein
5	9606.ENSP00000339374	0.669	Galectin-12
6	9606.ENSP00000392028	0.633	Chromodomain-helicase-DNA-binding protein 7
7	9606.ENSP00000225371	0.612	Eosinophil peroxidase
8	9606.ENSP00000465930	0.578	Galactokinase
9	9606.ENSP00000382595	0.560	Multifunctional protein ADE2
10	9606.ENSP00000337746	0.557	Inositol-3-phosphate synthase 1
11	9606.ENSP00000209668	0.556	Alcohol dehydrogenase 1A, alpha polypeptide
12	9606.ENSP00000296046	0.522	M14 carboxypeptidases

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.998	catalytic activity
GO:0097153	0.992	cysteine-type endopeptidase activity involved in apoptotic process
GO:0042802	0.709	identical protein binding
GO:0030246	0.620	carbohydrate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.979	biological regulation
GO:0050789	0.968	regulation of biological process
GO:0050794	0.939	regulation of cellular process
GO:0002682	0.777	regulation of immune system process
GO:0048583	0.766	regulation of response to stimulus
GO:0051249	0.766	regulation of lymphocyte activation
GO:0008152	0.762	metabolic process
GO:0032944	0.758	regulation of mononuclear cell proliferation
GO:0050670	0.744	regulation of lymphocyte proliferation
GO:0050863	0.726	regulation of T cell activation
GO:0042129	0.693	regulation of T cell proliferation
GO:0071704	0.682	organic substance metabolic process
GO:0050776	0.591	regulation of immune response
GO:0002697	0.571	regulation of immune effector process
GO:0050896	0.516	response to stimulus
GO:0060255	0.502	regulation of macromolecule metabolic process
GO:0008219	0.459	cell death
GO:0002706	0.443	regulation of lymphocyte mediated immunity
GO:0002819	0.442	regulation of adaptive immune response
GO:0046006	0.432	regulation of activated T cell proliferation
GO:0002822	0.424	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0044237	0.413	cellular metabolic process
GO:0044238	0.396	primary metabolic process
GO:0010468	0.366	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0071944	0.977	cell periphery
GO:0005829	0.941	cytosol
GO:0043231	0.875	intracellular membrane-bounded organelle
GO:0030312	0.806	external encapsulating structure
GO:0031012	0.749	extracellular matrix
GO:0062023	0.667	collagen-containing extracellular matrix
GO:0070013	0.391	intracellular organelle lumen
GO:0005634	0.364	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	0.992	Cysteine endopeptidases.

[back to server]